"The immobilization of cargo transport has been lifted," Transport Minister Jorge Eduardo Rojas told reporters.
|
|
With proper treatment—usually realignment, immobilization, and rest—most fractures heal completely within 4-10 weeks.
|
|
"We call upon the transport guilds to help us end this immobilization," Transport Minister Jorge Eduardo Rojas told journalists.
|
|
Typically, EMS is used in situations where a person has muscular inhibition and weakness, due to pain, swelling, and immobilization, he says.
|
|
In the first installment of our new Club Horror Stories column, Chrissy shares his pot-induced stroke-like immobilization on an airplane.
|
|
When you're Nike's VP of creative concepts and the most recognized sneaker designer of all time, full immobilization is off the table.
|
|
The chase ended when a police car nudged the fleeing vehicle in a PIT maneuver, also known as the precision immobilization technique.
|
|
For instance, one recent study found more than 68,000 videos associated with a common procedure known as a distal radius fracture immobilization.
|
|
Light fibreglass or heavy plaster (gypsum), white or colored, the immobilization angle, walking cast heels, slings, crutches, wheelchairs, accompanying clothing... You name it.
|
|
Ms. Ten said Mr. Apuzzi's increasing immobilization had presented a challenge to their relationship, which centered on exercising together and sharing handball glory as competitors.
|
|
Neither my position nor the extractions would rate high on the pain scale, but the contorted immobilization over 45 minutes made me wary of my fortitude.
|
|
Jay Leno gets a crash course in how to executes a PIT (Precision Immobilization Technique) developed by the police to disable cars without having to ram it.
|
|
Wildlife workers must immobilize the animal, ensure it is calm in the crate so it doesn't injure itself and then safely reverse the immobilization after the transport.
|
|
They managed to reverse "stiff-person syndrome" — a rare neurological disease that causes the muscles in the body contract to the point of complete immobilization — in one patient.
|
|
For more than two years, they hosted masterclasses at the Eagle London, teaching students the arts of immobilization, electrostimulation, flogging, safe bondage, pressure points, and everything in between.
|
|
As the researchers write in their study:This attack process has been termed immobilization wrapping and effectively renders the prey harmless before the spider bites it, and tests whether it is palatable.
|
|
Chicago-based producer and DJ Chrissy recalled his zombie-like immobilization and internal freakout after consuming a dozen pot-laced cookies before a flight back to the United States from Canada.
|
|
"We have demonstrated that using CO2 gas during micro-CT imaging effectively induces safe, repeatable, whole-body, and temporary immobilization of live insects for 3D visualizations without motion artefacts," concluded the authors in their study.
|
|
The big picture: Remote kill switches were designed to prevent theft, but can be compromised and used to steal or hijack cars, target high-profile individuals in their private vehicles, or shut down roadways through mass immobilization.
|
|
For example, he said, as a trauma surgeon, he wondered if the common practice of spine immobilization - putting a neck collar on and buckling a patient to a back board - is helpful or harmful for gunshot victims.
|
|
Dr. Steven Weinfeld, the chief of foot and ankle surgery at the Icahn School of Medicine at Mount Sinai Hospital, said the injury to Mitchell typically required four to six weeks of immobilization for the toe to heal.
|
|
Some fractures of the radial head, particularly when they are relatively minor will be treated for a few days with immobilization with either a sling or a split for comfort, at which time, early range of motion will be begun.
|
|
Rather than suffer the stereotypical nighttime immobilization, Levitas sees creatures moving in the corners of his room, puppies slipping under the door, clouds of smoke hovering above his bed, or other specters from the day that have sneakily maneuvered into his dream-like states.
|
|
Soon, Van Horn realized the chase was nearing a location that would offer him a perfect opportunity to execute a maneuver Van Horn had never used in his 20-year career: The PIT maneuver, or precision immobilization technique, a police tactic used to stop a fleeing car.
|
|
They were given to him in Beijing by the Chinese Academy of Space Technology, which got in touch after he suggested that the cause of Yutu's unexplained immobilization in 2014, after its first lunar sunrise, was a dust storm—and cheekily recommended that next time they equip the rover with a dust detector.
|
|
The company sent out a notice to users — presented in screenshots below, in German, with the full text translated underneath that — noting that it is currently investigating whether the malfunction is due to a software fault, where an update of the software causes a scooter inadvertently to reboot during a ride, thus engaging the anti-theft immobilization system.
|
|
While scooters strewn across a sidewalk will cause hand-wringing, and a single scooter fatality will drive headlines, of perhaps greater concern is that we accept as givens 37,000 yearly automobile fatalities, the immobilization of our cities because of car congestion, and the dedication of space for car storage that equates to six to nine parking spaces for every car in America.
|
|
Many immobilization techniques exist, such as adsorption, covalent binding, affinity, and entrapment. Ideal immobilization processes should not use highly toxic reagents in the immobilization technique to ensure stability of the enzymes. After immobilization is complete, the enzymes are introduced into a reaction vessel for biocatalysis.
|
|
Complete immobilization of the head and neck should be done as early as possible and before moving the patient. Immobilization should remain in place until movement of the head and neck is proven safe. In the presence of severe head trauma, cervical fracture must be presumed until ruled out. Immobilization is imperative to minimize or prevent further spinal cord injury.
|
|
Reducing a posterior sternoclavicular dislocation. Relieving pressure from a subungual hematoma. Maintaining manual, in-line stabilization of the spine, including long spine board immobilization and application of a cervical collar. Seated spinal immobilization, including use of the kendrick extrication device.
|
|
Immobilization in soil science is the conversion of inorganic compounds to organic compounds by micro-organisms or plants, by which it is prevented from being accessible to plants.Principles and Practices of Soil Science, the soil as a natural resource (4th edition), R.E. White Immobilization is the opposite of mineralization where the inorganic nutrients are taken up by soil microbes making them unavailable for plant uptake. Immobilization process is a biological process controlled by bacteria that consume an inorganic nitrogen and for, amino acids and biological macromolecuels (inorganic forms). Immobilization and mineralization happen continuously and concurrently whereby nitrogen of the decomposing system is transformed steadily from inorganic to organic state by immobilization and back from organic to inorganic state by decay and mineralization.
|
|
An EU contract for immobilization of a polluted area of 20,000 m3 in BAKAR Croatia based on Solidification/Stabilization with ImmoCem is currently in progress. After 3 years of intensive research by the Croatian government, the EU funded the immobilization project in BAKAR. The area is contaminated with large amounts of TPH, PAH and metals. For the immobilization, the contractor chose to use the mix-in-plant procedure.
|
|
Other NASICON applications include catalysis, immobilization of radioactive waste, and sodium removal from water.
|
|
Surgery in people with EDS requires careful tissue handling and a longer immobilization afterward.
|
|
Immobilization processes effectively remove selenium from the ecosystem, especially in slow-moving or still-water areas.
|
|
The majority of distal radius fractures are treated with conservative nonoperative management, which involves immobilization through application of plaster or splint with or without closed reduction. The prevalence of nonoperative approach to distal radius fractures is around 70%. Nonoperative management is indicated for fractures that are undisplaced, or for displaced fractures that are stable following reduction. Variations in immobilization techniques involve the type of cast, position of immobilization, and the length of time required in the cast.
|
|
It is sometimes used in combination with pain medications and sedatives for euthanasia and immobilization of horses.
|
|
Upper Saddle River: Pearson Prentice Hall, 2006. Other immobilization equipment consists of straps, or cravats, and cervical immobilization devices (CIDs). CIDs, which stabilize the neck and reduce movement, include a soft or rigid cervical spine immobilization collar, also called a c-collar or neck brace. In addition to the c-collar, commercial head supports or substituted items, such as bulky blankets, rolled towels, or foam head blocks, are placed on each side of the head and then secured to the backboard with tape.
|
|
The immobilized whole cell system is an alternative to enzyme immobilization. Unlike enzyme immobilization, where the enzyme is attached to a solid support (such as calcium alginate or activated PVA or activated PEI), in immobilized whole cell systems, the target cell is immobilized. Such methods may be implemented when the enzymes required are difficult or expensive to extract, an example being intracellular enzymes. Also, if a series of enzymes are required in the reaction; whole cell immobilization may be used for convenience.
|
|
Shorter immobilization is associated with better recovery when compared to prolonged immobilization. 10% of the minimally displaced fractures will become unstable in the first two weeks and cause malunion. Therefore, follow up within the first week of fracture is important. 22% of the minimally displaced fractures will malunite after two weeks.
|
|
Prolonged immobilization of the knee joint is also not recommended which result in stiffness of the joint and difficult recovery.
|
|
A traditional method of orthopedic treatment, involving less immobilization than Western methods, continued to be widely used in the 1980s.
|
|
It is not recommended for bites from non-neurotoxic snakes such as those found in North America and other regions of the world. The British military recommends pressure immobilization in all cases where the type of snake is unknown. The object of pressure immobilization is to contain venom within a bitten limb and prevent it from moving through the lymphatic system to the vital organs. This therapy has two components: pressure to prevent lymphatic drainage, and immobilization of the bitten limb to prevent the pumping action of the skeletal muscles.
|
|
In the case of joint pain secondary to capsulitis or synovitis, which are not destabilizing, complete immobilization of the joint should be avoided.
|
|
"Strapping Techniques in Spinal Immobilization". Adapted from the Annals of Emergency Medicine, June 1994-Tips from Other Journals. American Family Physician. October 1994.
|
|
Many technical applications of biological objects like proteins, viruses or bacteria such as chromatography, optical information technology, sensorics, catalysis and drug delivery require their immobilization. Carbon nanotubes, gold particles and synthetic polymers are used for this purpose. This immobilization has been achieved predominantly by adsorption or by chemical binding and to a lesser extent by incorporating these objects as guests in host matrices. In the guest host systems, an ideal method for the immobilization of biological objects and their integration into hierarchical architectures should be structured on a nanoscale to facilitate the interactions of biological nano-objects with their environment.
|
|
As a witch and Charmed One, Piper has also developed a number of magical powers which include molecular immobilization, molecular combustion, and molecular acceleration.
|
|
Arthrodesis is defined as, "the surgical immobilization of a joint so that the bones grow solidly together." "arthrodesis." Merriam-Webster.com. Merriam-Webster, 2011. Web. 2011.
|
|
Conservative treatment with external neck immobilization is less commonly reported , but may be very useful in select cases where immediate surgical intervention is not indicated.
|
|
Treatment involves pain medication and immobilization at first; later, physical therapy is used. Ice over the affected area may increase comfort.Wiedemann et al. (2000) p.
|
|
Spinal immobilization was historically used routinely for people who had experienced physical trauma. There is; however, little evidence for its routine use. Long spine boards are often used in the prehospital environment as part of spinal immobilization. Due to concerns of side effects the National Association of EMS Physicians and the American College of Surgeons recommend its use only in those at high risk.
|
|
Spine trauma and immobilization Prehospital care providers, such as paramedics and Emergency Medical Technicians (EMTs), utilize various immobilization techniques as treatment and management of patients with definite or potential spinal trauma. Common mechanisms of spinal cord injury include motor vehicle crashes, motorcycle crashes, pedestrian-vehicle collisions, falls, blunt trauma, penetrating trauma, and diving accidents.Mistovich, Joseph J., Brent Q. Hafen, and Keith J. Karren."Immobilizing a Patient to a Long Board".
|
|
However, most P compounds are not readily soluble in soils so it is not readily used for metal immobilization. Phosphate solubilizing bacteria (PSB) have the potential to enhance phosphate-induced immobilization of metals to remediate contaminated soil. However, there is a limit on the amount of phosphate which can be added to the environment due to the issue of eutrophication.Park, J. H., Bolan, N., Megharaj, M., & Naidu, R. (2011).
|
|
The duration of the immobilization is at the treating physician's discretion. After the immobilization period has ended, the cast will be removed and further analysis of the injury will be required. If the injury did not improve with the conservative courses of treatment, or if the injury was initially too severe for conservative treatment, invasive procedures may become necessary. Steroid injections and surgical procedures are the most prominent invasive procedures.
|
|
Empty hand techniques include joint locking, kicking, punching, throwing and immobilization. Weapons techniques include the knife, cane, rope, Dan bong, Jung Bong, Jang bong, So Bong and sword.
|
|
There are a variety of ways that permeable reactive membranes can be used in order to remediate groundwater. The two main processes are immobilization (AKA sequestration) and transformation.
|
|
The Kingdon Guide to African Mammals. Academic Press Limited, London. pp. 332–333. West, G., Heard, D., & Caulkett, N. (Eds.). (2008). Zoo animal and wildlife immobilization and anesthesia.
|
|
The use of pressure immobilization bandages, methylated spirits, or vodka is generally not recommended for use on jelly stings. In severe Chironex fleckeri stings cardiac arrest can occur quickly.
|
|
Full body spinal immobilization is the process by which a person with obvious or suspected spinal trauma is secured to a long backboard (LBB) in a neutral in-line position. The goal of immobilization is to effectively splint the spine in order to prevent movement and additional damage to the vertebral column and spinal cord.Shade, Bruce R., Mikel A. Rothenberg, Elizabeth Wertz, Shirley A. Jones, and Thomas E. Collins. "Head and Spinal Trauma".
|
|
Despite their excellent catalytic capabilities, enzymes and their properties must be improved prior to industrial implementation in many cases. Some aspects of enzymes that must be improved prior to implementation are stability, activity, inhibition by reaction products, and selectivity towards non-natural substrates. This may be accomplished through immobilization of enzymes on a solid material, such as a porous support. Immobilization of enzymes greatly simplifies the recovery process, enhances process control, and reduces operational costs.
|
|
The polyhistidine-tag can be successfully used for the immobilization of proteins on a surface such as on a nickel- or cobalt-coated microtiter plate or on a protein array.
|
|
Microbes degrade many fertilizers, e.g., by immobilization or oxidation. Furthermore, fertilizers are lost by evaporation or leaching. Most slow-release fertilizers are derivatives of urea, a straight fertilizer providing nitrogen.
|
|
Bionix Radiation Therapy, LLC offers medical devices including patient immobilization devices for treating cancer using external beam. The company supplies such devices for cancer clinics, radiotherapy centers and medical oncology practices.
|
|
As a consequence, Rees was away from motor racing for a period of 18 months - of which 12 months were spent under serious immobilization, and the remaining 6 months with continuous physiotherapy sessions.
|
|
In civil life, it is seldom diagnosed correctly for a week or two, when, because of lack of immobilization, there is an excessive deposit of callus (which may be palpable) around the fracture.
|
|
In fractures with little or no displacement, immobilization with a posterior splint may be sufficient. Elbows may be immobilized at 45°–90° of flexion for 3 weeks, followed by limited (90°) flexion exercises.
|
|
Most rehabilitation programs combine efforts to protect the joint with muscle strengthening and range of motion. During an immobilization period, isometric exercises, such as straight leg raises, are commonly used to restore muscle loss without disturbing the cartilage of the affected joint. Once the immobilization period has ended, physical therapy involves continuous passive motion (CPM) and/or low impact activities, such as walking or swimming. OCD occurs in 15 to 30 people per 100,000 in the general population each year.
|
|
There is some evidence that immobilization with the wrist in dorsiflexion as opposed to palmarflexion results in less redisplacement and better functional status. Significant angulation and deformity may require an open reduction and internal fixation or external fixation. The volar forearm splint is best for temporary immobilization of forearm, wrist and hand fractures, including Colles fracture. There are several established instability criteria: dorsal tilt >20°, comminuted fracture, abruption of the ulnar styloid process, intraarticular displacement >1mm, loss of radial height >2mm.
|
|
RARAF has implemented a microfluidic platform for the immobilization of Caenorhabditis elegans during microbeam irradiation.Buonanno M et al. Microbeam irradiation of C. elegans nematode in microfluidic channels. Radiation and environmental biophysics 1-7 (2013).
|
|
NPCs are progenitor cells that have the ability to differentiate into neurons or cells found in the brain. By coating the implant with NPCs, it can reduce the foreign body reaction and improve biocompatibility. To attach the NPCs, prior surface modification of the implant is required; these modifications can be done via the immobilization of laminin (an extracellular matrix derived protein) on an implant, such as silicon. To verify the success of surface immobilization, Fourier transform infrared spectroscopy (FTIR) and an analysis of hydrophobicity can be used.
|
|
Physical therapists can assist immobilized patients with effective cough techniques, secretion clearance, stretching of the thoracic wall, and suggest abdominal support belts when necessary. The amount of time a patient is immobilized may depend on the level of the spinal cord injury. Physical therapists work with the patient to prevent any complications that may arise due to this immobilization. Other complications that arise from immobilization include muscle atrophy and osteoporosis, especially to the lower limbs, increasing the risk of fractures to the femur and tibia.
|
|
Vitrification is not the only way to stabilize the waste into a form that will not react or degrade for extended periods. Immobilization via direct incorporation into a phosphate based crystalline ceramic host is also used. The diverse chemistry of phosphate ceramics under various conditions demonstrate a versatile material that can withstand chemical, thermal and radioactive degradation over time. The properties of phosphates, particularly ceramic phosphates, of stability over a wide pH range, low porosity and minimization of secondary waste introduces possibilities for new waste immobilization techniques.
|
|
Immobilization using entrapment relies on trapping enzymes within gels or fibers, using non-covalent interactions. Characteristics that define a successful entrapping material include high surface area, uniform pore distribution, tunable pore size, and high adsorption capacity.
|
|
Due to the large number of natural or synthetic polymers available and the advanced techniques developed to process such systems to nanofibres, rods, tubes etc. make polymers a good platform for the immobilization of biological objects.
|
|
Another widely used application of the immobilization approach together with enzymes has been the enzymatic reactions on immobilized substrates. This approach facilitates the analysis of enzyme activities and mimics the performance of enzymes on e.g. cell walls.
|
|
Re-engineering has produced Curli fibers, the amyloid component of extracellular material of biofilms, as a platform for programmable nanomaterial. These nanofibers were genetically constructed for specific functions, including adhesion to substrates, nanoparticle templating and protein immobilization.
|
|
Post-operative analgesics, namely a mix of opioids and NSAIDs, are usually required to control pain, inflammation and swelling. Straight leg raising and other isometric exercises are encouraged during the post-operative or immobilization period. A six to eight-week home or formal physical therapy program is usually instituted once the immobilization period has ended, incorporating range of motion, stretching, progressive strengthening, and functional or sport-specific training. During this time, patients are advised to avoid running and jumping, but are permitted to perform low impact activities, such as walking or swimming.
|
|
Snakebite first aid recommendations vary, in part because different snakes have different types of venom. Some have little local effect, but life-threatening systemic effects, in which case containing the venom in the region of the bite by pressure immobilization is desirable. Other venoms instigate localized tissue damage around the bitten area, and immobilization may increase the severity of the damage in this area, but also reduce the total area affected; whether this trade-off is desirable remains a point of controversy. Because snakes vary from one country to another, first aid methods also vary.
|
|
Hanford Tank Waste Treatment and Immobilization Plant in 2012 The Hanford Tank Waste Treatment and Immobilization Plant, known as the Vit Plant, is a facility for nuclear waste vitrification at the Hanford Site in Washington. Unlike the Environmental Restoration Disposal Facility at Hanford, designed to hold tens of millions of tons of low-level waste, the Vit Plant is designed to immobilize smaller quantities of high-level waste including plutonium. According to prime contractor Bechtel it was designed for of liquid waste. It was designed to be the world's largest vitrification plant.
|
|
Immediately prior to target introduction, the single stranded oligonucleotide library is often heated and cooled slowly to renature oligonucleotides into thermodynamically stable secondary and tertiary structures. Once prepared, the randomized library is incubated with immobilized target to allow oligonucleotide-target binding. There are several considerations for this target incubation step, including the target immobilization method and strategies for subsequent unbound oligonucleotide separation, incubation time and temperature, incubation buffer conditions, and target versus oligonucleotide concentrations. Examples of target immobilization methods include affinity chromatography columns, nitrocellulose binding assay filters, and paramagnetic beads.
|
|
Immobilization also provided researchers with the ability to put earlier discoveries into practice, in particular the discovery of enzymes that can be used to directly transfer electrons from the enzyme to the electrode. This process had been understood since the 1980s but depended heavily on placing the enzyme as close to the electrode as possible, which meant that it was unusable until after immobilization techniques were devised. In addition, developers of enzymatic biofuel cells have applied some of the advances in nanotechnology to their designs, including the use of carbon nanotubes to immobilize enzymes directly.
|
|
American Cancer Society 2008; National Capital Poison Center 2010 Soils contaminated by heavy metals can be remediated by one or more of the following technologies: isolation; immobilization; toxicity reduction; physical separation; or extraction. Isolation involves the use of caps, membranes or below-ground barriers in an attempt to quarantine the contaminated soil. Immobilization aims to alter the properties of the soil so as to hinder the mobility of the heavy contaminants. Toxicity reduction attempts to oxidise or reduce the toxic heavy metal ions, via chemical or biological means into less toxic or mobile forms.
|
|
People with factor V Leiden are at a relatively low risk of thrombosis, but may develop thrombosis in the presence of an additional risk factor, such as immobilization. Most people with the prothrombin mutation (G20210A) never develop thrombosis.
|
|
Treatment is difficult, often requiring a joint replacement. Spontaneous improvement occasionally happens and some juxta-articular lesions do not progress to collapse. Other treatments include immobilization and osteotomy of the femur. Cancellous bone grafts are of little help.
|
|
These sprains require surgical fixation, prolonged immobilization, and physical therapy. Sprains can occur at any joint but most commonly occur in the ankle, knee, or wrist. An equivalent injury to a muscle or tendon is known as a strain.
|
|
Colloid Polym. Sci, vol. 103, pp. 243-250 (1997).. In a study of functionalized poly(ethylene glycol)-based bioassays, he helped discover a new surface chemistry which inhibits nonspecific biomolecular interactions and provides the capacity for specific immobilization of desired biomolecules.
|
|
Find Articles.com. 24 June 2008. . Immobilization equipment A long backboard, also called a long spine board (LSB), is a reinforced, firm surface with several hand and strap holes along its lateral edges.Bledsoe, Bryan E., Robert S. Porter, and Richard A. Cherry.
|
|
The most common causes of hypercalcemia are certain types of cancer, hyperparathyroidism, hyperthyroidism, pheochromocytoma, excessive ingestion of vitamin D, sarcoidosis, and tuberculosis. Hyperparathyroidism and malignancy are the predominate causes. It can also be caused by muscle cell breakdown, prolonged immobilization, dehydration.
|
|
In order to increase the specificity of aptamers selected by a given SELEX procedure, a negative selection, or counter selection, step can be added prior to or immediately following target incubation. To eliminate sequences with affinity for target immobilization matrix components from the pool, negative selection can be used where the library is incubated with target immobilization matrix components and unbound sequences are retained. Negative selection can also be used to eliminate sequences that bind target-like molecules or cells by incubating the oligonucleotide library with small molecule target analogs, undesired cell types, or non-target proteins and retaining the unbound sequences.
|
|
First, IRIS integrated a fluorescence imaging capability into the interferometric imaging instrument as a potential way to address fluorescence protein microarray variability. Briefly, the variation in fluorescence microarrays mainly derives from inconsistent protein immobilization on surfaces and may cause misdiagnoses in allergy microarrays. To correct from any variation in protein immobilization, data acquired in the fluorescence modality is then normalized by the data acquired in the label-free modality. IRIS has also been adapted to perform single nanoparticle counting by simply switching the low magnification objective used for label-free biomass quantification to a higher objective magnification.
|
|
Enzymes immobilised in beads of alginate gel An immobilized enzyme is an enzyme attached to an inert, insoluble material—such as calcium alginate (produced by reacting a mixture of sodium alginate solution and enzyme solution with calcium chloride). This can provide increased resistance to changes in conditions such as pH or temperature. It also lets enzymes be held in place throughout the reaction, following which they are easily separated from the products and may be used again - a far more efficient process and so is widely used in industry for enzyme catalysed reactions. An alternative to enzyme immobilization is whole cell immobilization.
|
|
However, studies have identified that gait patterns in deafferented or immobilized animals are more simplistic than in neurologically intact animals. (Deafferentation and immobilization are experimental preparations of animals to study neural control. Deafferentation involves transecting the dorsal roots of the spinal cord that innervate the animal's limbs which impedes transmission of sensory information while keeping motor innervation of muscles intact. In contrast, immobilization involves injecting an acetylcholine inhibitor which impedes the transmission of motor signals while sensory input is unaffected.) The complexity of gait arises from the need to adapt to expected and unexpected changes in the environment (e.g.
|
|
General chemical structure of a polydiacetylene Polydiacetylenes (PDAs) are a family of conducting polymers closely related to polyacetylene. They are created by the 1,4 topochemical polymerization of diacetylenes. They have multiple applications from the development of organic films to immobilization of other molecules.
|
|
No more attacks followed, and by April 5 the Soviets withdrew from the area as further delay would have risked the loss or immobilization of guns and sleighs in spring mud. The Allies began evacuation from Arkhangelsk immediately after the thaw of ice.
|
|
Oxygen deprivation that occurs as the result of immobilization (bed rest), glucocorticoid treatment, and withdrawal of oxygen have all been shown to promote osteocyte apoptosis. It is now recognized that osteocytes respond in a variety of ways to the presence of implant biomaterials.
|
|
The balance between immobilization and mineralization processes depends on the balance and availability of major nutrients and organic carbon to soil microorganisms.Sims, G. K., and M. M. Wander. 2002. Proteolytic activity under nitrogen or sulfur limitation. Appl. Soil Ecol. 568:1-5.
|
|
One solution has been to use three- dimensional electrodes or immobilization on conducting carbon supports which provide high surface area. These electrodes are extended into three- dimensional space which greatly increases the surface area for enzymes to bind thus increasing the current.
|
|
Microbial degradation of organic carbon sorbed to phyllosilicate clays with and without hydrous iron oxide coating. European Journal of Soil Science 66: 83–94. It also depends on SOM fractions (e.g., stabilized organic molecules and microbial biomass) by mineralization and immobilization processes.
|
|
Retrieved 2020-08-24. push it tough, parallel immobilization technique, and precision intervention tactic. The technique is also known as tactical car intervention, tactical ramming, legal intervention, and fishtailing. The technique is used by law enforcement officers to bring car chases to a conclusion.
|
|
Due to thermal and mechanical stability, non-toxicity, and high resistance against microbial attacks and organic solvents, perlite is widely used in biotechnological applications. Perlite was found to be an excellent support for immobilization of biocatalysts such as enzymes for bioremediation and sensing applications.
|
|
The chemical and physical properties of platinum nanoparticles (NP) make them applicable for a wide variety of research applications. Extensive experimentation has been done to create new species of platinum NPs, and study their properties. Platinum NP applications include electronics, optics, catalysts, and enzyme immobilization.
|
|
Most hip fractures are treated surgically by implanting a prosthesis. Surgical treatment outweighs the risks of nonsurgical treatment which requires extensive bedrest. Prolonged immobilization increases risk of thromboembolism, pneumonia, deconditioning, and decubitus ulcers. Regardless, the surgery is a major stress, particularly in the elderly.
|
|
Treatment includes anti-inflammatory medications and immobilization of the neck in addition to treatment of the offending infectious cause (if any) with appropriate antibiotics. Early treatment is crucial to prevent long-term sequelae. Surgical fusion may be required for residual instability of the joint.
|
|
It can also cause injury to the fish. The electricity causes muscle spasms that damage the vertebrae. For unknown reasons,2003 study: Immobilization Thresholds of Electrofishing Relative to Fish Size, biologists Chad Dolan and Steve Miranda this is more common and severe in longer fish.
|
|
Regulatory and fiscal authorities sometimes regard bearer securities negatively, as they may be used to facilitate the evasion of regulatory restrictions and tax. In the United Kingdom, for example, the issue of bearer securities was heavily restricted firstly by the Exchange Control Act 1947 until 1953. Bearer securities are very rare in the United States because of the negative tax implications they may have to the issuer and holder. In Luxembourg, the law of 28 July 2014 concerning the compulsory deposit and immobilization of shares and units in bearer form adopts the compulsory deposit and immobilization of bearer shares and units with a depositary allowing identification of the holders thereof.
|
|
As of a 2018 review evidence of overtreatment overmedicalization, and overdiagnosis in Pediatrics have been use of commercial rehydration solution, antidepressants, and parenteral nutrition; overmedicalization with planned early deliveries, immobilization of ankle injuries, use of hydrolyzed infant formula; and overdiagnosis of hypoxemia among children recovering from bronchiolitis.
|
|
Some of Grainger’s work with biomaterials is focused on surface modificationHarbers, Gregory M., et al. “Functionalized Poly(Ethylene Glycol)-Based Bioassay Surface Chemistry That Facilitates Bio-Immobilization and Inhibits Nonspecific Protein, Bacterial, and Mammalian Cell Adhesion.” Chemistry of Materials, vol. 19, no. 18, pp. 4405–4414 (2007).
|
|
The mucus trails from the slime of slugs, snails and other planarians orient planarians towards their prey. Different species use different techniques for capturing and immobilizing their prey, such as entrapment with sticky mucus and immobilization by physical force. Cannibalism has been observed in land planarians.
|
|
She developed enzyme immobilization membranes to improve the stability of biosensor and biofuel electrodes. In 2003 Minteer and her graduate student Nick Akers co-founded Akermin to commercialise their work on mitochondria- based biofuel cells. She was made a full professor at Saint Louis University in 2008.
|
|
Polym Int 2010, 59 (7), 923-930. nuclear waste management,Scheetz, B. E.; Agrawal, D. K.; Breval, E.; Roy, R., Sodium zirconium phosphate (NZP) as a host structure for nuclear waste immobilization: A review. Waste Manage 1994, 14 (6), 489-505. clinical dialyzer,Nissenson, A.; Fine, R., Clinical dialysis.
|
|
Immobilized cell technology is a method of air filtration and purification that uses whole cell immobilization. It is a process whereby microfine particulate matter is removed from the air by attracting charged particulates in the air to a bio-reactive mass, or bioreactor, which enzymatically renders them inert.
|
|
Limb should be reduced and placed in a well-padded splint for immobilization of fractures. Pulses should be documented before and after reduction. Wound cultures are positive in 22% of pre-debridement cultures and 60% of post-debridement cultures of infected cases. Therefore, pre-operative cultures no longer recommended.
|
|
If spasticity is left untreated, contractures can occur. A loss of muscle tone inhibition causes a muscle to become hyperactive resulting in constant contraction, which reduces an individual’s control of the affected area. The joint will remain in a flexed state producing similar effects as listed in immobilization.
|
|
Zehr, J. L. NIH Public Access. 41, 101–112 (2005). Immobilization of the female also occurs in muscovy ducks. Grasping and/or grappling mating situations have also been documented in Calopteryx haemorrhoidalis haemorrhoidalis (Odonata),Rivera, a C. & Andrés, J. a Male coercion and convenience polyandry in a calopterygid damselfly.
|
|
Cementitious wasteforms require a careful selection and design process adapted to each specific type of waste to satisfy the strict waste acceptance criteria for long-term storage and disposal.Abdel Rahman R.O., Rahimov R.Z., Rahimova N.R., Ojovan M.I. (2015). Cementitious materials for nuclear waste immobilization. Wiley, Chichester 232 pp.
|
|
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP.
|
|
Wrist brace used in sports They are indicated for wrist trauma with and without fracture, immobilization of the joint, postoperative synovitis, recurrent degenerative sprains or articulation inflammations, among many other cases. In rehabilitation to immobilize the wrist into a neutral position, which "theoretically minimizes stress at the repair site".
|
|
Delirium can be caused by the worsening of previous medical conditions, substance abuse or withdrawal, mental illness, severe pain, immobilization, sleep deprivation and hypnosis. Other common causes that may increase the risk of delirium include infections of urinary tract, skin and stomach, pneumonia, old age, and poor nutrition.
|
|
However, prolonged bed rest (greater than 80 days) does significantly change the number of MHC hybrid fibers observed in the soleus muscle. Immobilization by limb casting does not seem to reduce the relative proportions of muscle-specific proteins, such as carbonic anhydrase II and myoglobin, over that predicted by the overall decrease in muscle protein synthesis. In contrast, experimental evidence suggests that the specific activity of muscle enzymes involved in oxidative metabolism, such as pyruvate dehydrogenase, is decreased by cast immobilization. A similar reduction in the activity of citrate synthase, but not phosphofructokinase, has been detected in the vastus lateralis, indicating a significant impairment of the oxidative capacity in this muscle after unilateral limb suspension.
|
|
Outline of the stages of the PIT maneuver The PIT maneuver (pursuit intervention technique) or TVI (tactical vehicle intervention) is a pursuit tactic by which a pursuing car can force a fleeing car to turn sideways abruptly, causing the driver to lose control and stop. Other names include pit block, pit stop, and blocking.Law Enforcement Pursuits in Georgia: Review and Recommendations It was developed and named by the Fairfax County Police Department of Virginia, United States. Other interpretations of the acronym "PIT" include pursuit immobilization technique, precision immobilization technique,Raviv, Shaun, and John Sullivan, "Police driving maneuver used to end chases has killed 30 people since 2016, The Post finds", Washington Post, August 24, 2020.
|
|
Numerous enzymes of biotechnological importance have been immobilized on various supports (inorganic, organic, composite and nanomaterials) via random multipoint attachment. However, immobilization via random chemical modification results in a heterogeneous protein population where more than one side chains (amino, carboxyl, thiol etc) present in proteins are linked with the support with potential reduction in activity due to restriction of substrate access to the active site. In contrast, in site- directed enzyme immobilization, the support can be linked to a single specific amino acid (generally N- or C-termini) in a protein molecule away from the active-site. This way maximal enzyme activity is retained due to the free access of the substrate to the active-site.
|
|
Primary care paramedics (PCP) are the entry-level of paramedic practice in Canadian provinces. The scope of practice includes performing semi-automated external defibrillation, interpretation of 4-lead ECGs, administration of Symptom Relief Medications for a variety of emergency medical conditions (these include oxygen, epinephrine, dextrose, glucagon, salbutamol, ASA and nitroglycerine), performing trauma immobilization (including cervical immobilization), and other fundamental basic medical care. Primary Care Paramedics may also receive additional training in order to perform certain skills that are normally in the scope of practice of Advanced Care Paramedics. This is regulated both provincially (by statute) and locally (by the medical director), and ordinarily entails an aspect of medical oversight by a specific body or group of physicians.
|
|
Binding affinity is a measure of dynamic equilibrium of the ratio of on-rate (kon) and off-rate (koff) under specific concentrations of reactants. The affinity constant, Ka, is the inverse of the dissociation constant, Kd. The strength of complex formation in solution is related to the stability constants of complexes, however in case of large biomolecules, such as receptor-ligand pairs, their interaction is also dependent on other structural and thermodynamic properties of reactants plus their orientation and immobilization. There are several methods to investigate protein–protein interactions existing with differences in immobilization of each reactant in 2D or 3D orientation. The measured affinities are stored in public databases, such as the Ki Database and BindingDB.
|
|
If the vehicle is not ordered forfeited under section 625n, the court shall order vehicle immobilization under section 904d in the judgment of sentence. ::(4) Beginning October 31, 2010, a person who operates a vehicle in violation of subsection (2) and by the operation of that vehicle causes the death of another person is guilty of a felony punishable by imprisonment for not more than 15 years or a fine of not less than $2,500.00 or more than $10,000.00, or both. The judgment of sentence may impose the sanction permitted under section 625n. If the vehicle is not ordered forfeited under section 625n, the court shall order vehicle immobilization under section 904d in the judgment of sentence.
|
|
Calcitonin was putatively linked to increased chance of cancer. The European Medicines Agency (EMA) recommended that calcitonin be used only on a short-term basis for 3 conditions for which it had previously been approved in the European Union: Paget's disease, acute bone loss resulting from sudden immobilization, and hypercalcemia caused by cancer. As a solution for injection or infusion, calcitonin should be administered for no more than 4 weeks to prevent acute bone loss resulting from sudden immobilization, and normally for no more than 3 months to treat Paget's disease, the EMA said. The agency did not specify a time frame for the short-term use of calcitonin for treating hypercalcemia caused by cancer.
|
|
There are many possible causes for compression of the tibial nerve therefore there are a variety of prevention strategies. One being immobilization, by placing the foot in a neutral position with a brace, pressure is relieved from the tibial nerve thus reducing patients pain.Gondring, William H., Elly Trepman, and Byron Shields.
|
|
The ryanodine receptor 1 (RyR1) is expressed in skeletal muscles in mammals . The alterations in the calcium potentials which are caused by intrepicalcin interaction with RyR1, affect these skeletal muscles and result in muscular paralysis. This can contribute to the immobilization of the predators and preys of the scorpion Vaejovis intrepidus .
|
|
Immobilization using affinity relies on the specificity of an enzyme to couple an affinity ligand to an enzyme to form a covalently bound enzyme-ligand complex. The complex is introduced into a support matrix for which the ligand has high binding affinity, and the enzyme is immobilized through ligand- support interactions.
|
|
Rigid braces that support the head and chest are also prescribed.. Examples include the Sterno-Occipital Mandibular Immobilization Device (SOMI), Lerman Minerva and Yale types. Special patients, such as very young children or non-cooperative adults, are sometimes still immobilized in medical plaster of paris casts, such as the Minerva cast.
|
|
Isolation of phosphate solubilizing bacteria and their potential for lead immobilization in soil. Journal of hazardous materials, 185(2), 829-836. Phosphate is often adsorbed onto the surface of different type of minerals, for example iron containing minerals. Recent data suggest that bacteria growing under phosphorus starvation release iron-chelating molecules.
|
|
It did, of course, result in the temporary breakup of the small band of clandestine organizers. Despite the reports of hundreds or even thousands of participants, and the temporary immobilization of the French authority in much of My Tho province, it seems that the number of core activists was relatively small.
|
|
Unfortunately, this immobilization technique is potentially life-threatening for mammals (but not for reptiles). Mammals would undergo states of bradycardia or hypoxia as an over-activation of parasympathetic vagus system. The organs of the oxygen- hungry mammal are deprived of oxygen due to lack of blood flow, and the animal dies.
|
|
Patients are immobilized and in bed for many days; they are frequently catheterised, commonly causing infection. Prolonged immobilization and difficulty moving make it hard to avoid pressure sores on the sacrum and heels of patients with hip fractures. Whenever possible, early mobilization is advocated; otherwise, alternating pressure mattresses should be used.
|
|
GNP-glucose oxidase monolayer electrode was constructed use these two methods. The Au NP allowed more freedom in the enzyme's orientation and therefore more sensitive and stable detection. Au NP also acts as immobilization platform for the enzyme. Most biomolecules denatures or lose its activity when interacted with the electrode.
|
|
Aside from surgery, there are a few options for handling an accessory navicular bone that has become symptomatic. This includes immobilization, icing, medicating, physical therapy, and orthotic devices. Immobilizing involves placing the foot and ankle in a cast or removable walking boot. This alleviates stressors on the foot and can decrease inflammation.
|
|
During the immobilization period, it is important to keep the foot flexible by lightly stretching the foot and calf regularly. As the plantar fascia recovers, physical therapy exercises help stabilize the ankle and correct gait patterns that may have contributed to the tear. Stretching and strengthening exercises decrease the chance of reinjury.
|
|
In almost all cases, recluse bites are self- limited and typically heal without any medical intervention. Recommendations to limit the extent of damage include elevation and immobilization of the affected limb, application of ice. Both local wound care, and tetanus prophylaxis are simple standards. There is no established treatment for more extensive necrosis.
|
|
Unlike NAPPA, PISAHe, M. and M. J. Taussig (2001). "Single step generation of protein arrays from DNA by cell-free expression and in situ immobilisation (PISA method)." Nucleic Acids Res 29(15): E73-3. completely bypasses DNA immobilization as the DNA template is added as a free molecule in the reaction mixture.
|
|
Figure 2: the matrix can play into other pathways inside the cell even through just its physical state. Matrix immobilization inhibits the formation of fibrillar adhesions and matrix reorganization. Likewise, players of other signaling pathways inside the cell can affect the structure of the cytoskeleton and thereby the cell's interaction with the ECM.
|
|
External pressure may help in immobilization but also is thought to reduce the tendency of the fluid to leak out of vessels by increasing the back-pressure on those fluid sources. Following breast augmentation or double mastectomy, binding the chest may be recommended for several weeks to minimize the risk of seromas.
|
|
The Russo-Japanese War was the first test of the new concepts. The war was a stunning victory for Japan, opening with the blockade and gradual immobilization of the Russian Pacific Fleet at Port Arthur and culminating in the destruction of the Russian Baltic Fleet at the Battle of Tsushima in 1905.
|
|
The components of an effective rehabilitation program for all sprain injuries include increasing the range of motion of the affected joint and progressive muscle strengthening exercises. After implementing conservative measures to reduce swelling and pain, mobilizing the limb within 48–72 hours following injury has been shown to promote healing by stimulating growth factors in musculoskeletal tissues linked to cellular division and matrix remodeling. Prolonged immobilization can delay the healing of a sprain, as it usually leads to muscle atrophy and weakness. Although prolonged immobilization can have a negative effect on recovery, a study in 1996 suggest that the use of bracing can improve healing by alleviating pain and stabilizing the injury to prevent further damage to the ligament or re-injury.
|
|
Prescribers should consider risk factors for pulmonary embolism, including age, obesity, smoking, and immobilization before prescribing this medication. Patients taking this medication, irrespective of indication or risk factors, should be monitored for signs and symptoms of pulmonary embolism.FDA Warns of Risk for PE, Death With Higher Dose Tofacitinib (Xeljanz) for RA - Medscape - Feb 25, 2019.
|
|
The P4O10 cagelike structure, resembling that of adamantane, which provides the basic building block for phosphate glass formers. Phosphate glasses are highly resistant to hydrofluoric acid. With an addition of iron oxide, they act as efficient heat absorbers. Iron phosphate and lead iron phosphate glass are alternatives to borosilicate glass for immobilization of radioactive waste.
|
|
Recommended efforts include exercises to improve the strength of the quadriceps, hamstring and gastrocnemius muscles. Bracing or use of an orthopedic cast to enforce joint immobilization is rarely required and does not necessarily encourage a quicker resolution. However, bracing may give comfort and help reduce pain as it reduces strain on the tibial tubercle.
|
|
Back strain is treated using analgesics such as ibuprofen, rest and use of ice packs. The patient can resume activities 24-48 hours after pain and swelling is reduced. It is not recommended to have prolonged immobilization or bed rest. If the pain does not subside in two weeks, additional treatment may be required.
|
|
Whether the decomposition of an organic compound will result in mineralization or immobilization is dependent on its concentration proportionate to that of the carbon in the organic matter. As a rule of thumb, if the concentration of a specific element exceeds the needs of the decomposer for biosynthesis or storage, then it will mineralize.
|
|
Born in Ornans in 1747, he was the son of a pharmacist from Besançon, where he studied medicine. In 1777 he joined the French Army as a surgeon. Soon, in contrast to the traditional immobilization technique, he introduced remedial gymnastics. In 1780 he published his own ideas about physiotherapy, obtaining considerable attentions and honors.
|
|
Other research using spongin scaffolds for the immobilization of Trametes versicolor Laccase has shown similar results in phenol degradation.Zdarta, Antecka, Frankowski, Zgoła-Grześkowiak, Ehrlich, and Jesionowski. "The Effect of Operational Parameters on the Biodegradation of Bisphenols by Trametes Versicolor Laccase Immobilized on Hippospongia Communis Spongin Scaffolds." Science of the Total Environment 615 (2018): 784-95. Web.
|
|
Because of their intelligence, control is often difficult or expensive. Methods for control include hunting, chemical immobilization, harassment and scare tactics, and trapping. Before any measure is used to confine, trap, kill, poison, immobilize, or alter the habits of any wild bird species, a person must check local, state, and federal regulations pertaining to such actions.
|
|
A Russell's viper is being "milked". Laboratories use extracted snake venom to produce antivenom, which is often the only effective treatment for potentially fatal snakebites. As of 2008, clinical evidence for pressure immobilization via the use of an elastic bandage is limited. It is recommended for snakebites that have occurred in Australia (due to elapids which are neurotoxic).
|
|
495x495px Many binding chemistries may be used to adhere an enzyme to a surface to varying degrees of success. The most successful covalent binding techniques include binding via glutaraldehyde to amino groups and N-hydroxysuccinide esters. These immobilization techniques occur at ambient temperatures in mild conditions, which have limited potential to modify the structure and function of the enzyme.
|
|
Although the egg begins inside of the spider, eventually it will hatch into a larva. It does not use an immobilization or paralyzing agent, so the spider develops as the egg/larva develops. As time progresses, the larva bursts out of the spider and continues as an ectoparasitoid. The larva will develop using the nutrients from the spider's hemolymph.
|
|
Spinal precautions, also known as spinal immobilization and spinal motion restriction, are efforts to prevent movement of the spine in those with a risk of a spine injury. This is done as an effort to prevent injury to the spinal cord. It is estimated that 2% of people with blunt trauma will have a spine injury.
|
|
This includes: those with blunt trauma who have a decreased level of consciousness, pain or tenderness in the spine, those with numbness or weakness believed to be due to a spinal injury, and those with a significant trauma mechanism that are intoxicated or have other major injuries. In those with a definite spinal cord injury immobilization is also recommended.
|
|
Fractures of the radius bone are often associated by TFCC damage. If the fracture is treated surgically it is recommended to evaluate and if necessary repair the TFCC as well. Closed fractures (where the skin is still intact) of the radius bone are treated non-surgically with cast; the immobilization can also help heal the TFCC.
|
|
The first form is to covalently immobilize the organic compounds on the solid surface with diverse linking techniques; this platform is usually called Small Molecule Microarray, which is invented and advanced by Dr. Stuart Schreiber and colleagues . The second form is to spot and dry organic compounds on the solid surface without immobilization, this platform has a commercial name as Micro Arrayed Compound Screening (μARCS), which is developed by scientists in Abbott Laboratories . The last form is to spot organic compounds in a homogenous solution without immobilization and drying effect, this platform is developed by Dr. Dhaval Gosalia and Dr. Scott Diamond and later commercialized as DiscoveryDot technology by Reaction Biology Corporation . Polymer Microarrays Polymer microarrays have been developed to allow screening for new polymeric materials to direct different tissue lineages.
|
|
Subsequent follow ups at two to three weeks are therefore also important. Where the fracture is undisplaced and stable, nonoperative treatment involves immobilization. Initially, a backslab or a sugar tong splint is applied to allow swelling to expand and subsequently a cast is applied. Depending on the nature of the fracture, the cast may be placed above the elbow to control forearm rotation.
|
|
There has been successful implementation of various phage preparation around the globe. Various applications/delivery methods in food have been developed. Bacteriophages and their endolysins can be incorporated into food systems in several ways such as spraying, dipping or immobilization, singly or in combination with other hurdles. The phage preparation LMP-1O2 has been subsequently commercialized as "ListShield" Intralyx, Inc.
|
|
Joints are usually immobilized in a shortened position resulting in changes within the joint connective tissue, and the length of the muscle and associated tendon. Prolonged immobilization facilitates tissue proliferation which impinges on the joint space. Maintaining a shortened position for a prolonged period of time leads to: fibrous adhesion formation, loss of sarcomeres, and a loss of tissue extensibility.
|
|
Hippocratic therapy focused on simply easing this natural process. To this end, Hippocrates believed "rest and immobilization [were] of capital importance." In general, the Hippocratic medicine was very kind to the patient; treatment was gentle, and emphasized keeping the patient clean and sterile. For example, only clean water or wine were ever used on wounds, though "dry" treatment was preferable.
|
|
Through continued research a more successful form of D-amino acid oxidase was discovered from a yeast species named Rhodotorula gracilis and therefore was named RgDAAO. RgDAAO is now used as the primary D-amino acid oxidase used in cephalosporin antibiotics because the immobilization on commercial ion exchange resins creates a more stable system that yields much higher amounts of antibiotics.
|
|
In most countries high-level radioactive waste has been incorporated into alkali borosilicate or phosphate vitreous waste forms for many years; vitrification is an established technology.M. I. Ojovan and W.E. Lee. An Introduction to Nuclear Waste Immobilisation, Elsevier, Amsterdam, 315 p. (2005) Vitrification is a particularly attractive immobilization route because of the high chemical durability of the vitrified glass product.
|
|
The malformations of arthrogryposis can be secondary to environmental factors such as: decreased intrauterine movement, oligohydramnios (low volume or abnormal distribution of intrauterine fluid), and defects in the fetal blood supply. Other causes could be: hyperthermia, limb immobilization and viral infections. Myasthenia gravis of the mother leads also in rare cases to arthrogryposis. The major cause in humans is fetal akinesia.
|
|
Most proximal humerus fractures are stable and can be treated without surgery. Typical non-operative treatment consists of shoulder immobilization with a sling. Close follow-up and weekly x-rays are recommended in order to ensure that the fracture is healing and maintaining good alignment. Passive range of motion exercises for the shoulder can be done when pain has subsided.
|
|
Alginic acid, or alginate, is extracted from brown algae. Its uses range from gelling agents in food, to medical dressings. Alginic acid also has been used in the field of biotechnology as a biocompatible medium for cell encapsulation and cell immobilization. Molecular cuisine is also a user of the substance for its gelling properties, by which it becomes a delivery vehicle for flavours.
|
|
University of Adelaide Clinical Toxinology Resource Treatment is the same for all Australian venomous snakes. The pressure immobilization method is used to inhibit the flow of venom through the lymphatic system. Broad, thick bandages are applied over the bite, then down and back along the limb to the armpit or groin. The affected limb is then immobilized with a splint.
|
|
In these situations, a rigid brace may be needed. Once again, the brace is specifically for immobilization and support. It should be worn whenever the patient is out of bed for more than 10 minutes. This brace will be worn for approximately several months after surgery but your doctor or surgeon will let the patient know if such a brace is necessary.
|
|
The Canadian C-spine rule for those with a normal Glasgow coma scale and who are otherwise stable Paramedics are able to accurately determine who needs or does not need neck immobilization based on an algorithm. There are two main algorithms, the Canadian C-spine rule and NEXUS. The Canadian C-spine rule appears to be better. However, following either rule is reasonable.
|
|
The latest generation of the system is called Strep-Tactin XT. In combination with the Twin Strep-tag it binds the recombinant protein of interest with an extremely high affinity. This results in improved batch purification runs, higher yields of the expressed recombinant protein and a versatile approach for the immobilization on solid surfaces like beads, slides/arrays or microplates.
|
|
A local anesthetic can reduce the pain. First aid includes immersion of the affected limb in hot water; this is thought to help denature the proteins in the venom. The immobilization of venom at penetration site using a tourniquet or firm constrictive bandaging is no longer recommended. Surviving victims may have nerve damage, which can lead to local muscle atrophy.
|
|
The advantage of this method over other forms of immobilization of the catalyst is that the enzymes are not altered in activity or selectivity as it remains solubilized. The principle can be applied to all macromolecular catalysts which can be separated from the other reactants by means of filtration. So far, only enzymes have been used to a significant extent.
|
|
SPR imaging can be used to study the binding of antibodies to protein array. Amine functionalities on the gold surface with proteins array, is used to study binding of antibodies. Immobilization of the protein was done by flowing protein solutions through the PDMS micro channels. Then PDMS was removed from the surface and solutions of antibody were flowed over the array.
|
|
Numerous pinning techniques have been proposed, however there is not enough evidence to determine which is more effective. Pinning involves the manipulation, with X-ray guidance, of the fracture into an acceptable position, and the immediate insertion of metal pins, called Kirschner wires, through the skin, into one bone fragment and across the fracture line into the other bone fragment. These pins are normally left in position for some four to six weeks, and are removed when the fracture has healed. Considerations include the technique chosen for skin incision, pin configuration, how many pins, the size of the pins, pin exposure (whether or not the pins are sticking out of the skin), the length of immobilization after the fracture has been pinned, the type of immobilization, how long the pins are left in place, the method for removing the pins.
|
|
The authors found that learned helplessness increases the levels of dynorphins A and B in the hippocampus and nucleus accumbens and that injecting KOR antagonist norBNI induces recovery from learned helplessness. Immobilization stress causes increases in the levels of both dynorphins A and B in the hippocampus and nucleus accumbens. Forced swim stress increases the levels of dynorphin A in the hippocampus. Shirayama et al.
|
|
Several different short single-stranded DNA molecules (oligonucleotides) are used in a branched DNA-assay. The capture and capture-extender oligonucleotide bind to the target nucleic acid and immobilize it on a solid support. The label oligonucleotide and the branched DNA then detects the immobilized target nucleic acid. The immobilization of the target on a solid support makes extensive washing easier, which reduces false positive results.
|
|
People with CIP/CIM have diffuse, symmetric, flaccid muscle weakness. CIP/CIM typically develops in the setting of a critical illness and immobilization, so patients with CIP/CIM are often receiving treatment in the intensive care unit (ICU). Weakness (motor deficits) occurs in generalized fashion, rather than beginning in one region of the body and spreading. Limb and respiratory (diaphragm) muscles are especially affected.
|
|
Hofer distinguished between prolonged immobility and faked death phenomenon. Unlike the behavior of "hopelessness" described by Richter, the death-faking occurred with a sudden motor collapse during active struggling. Hofer interpreted the fear- inducing slowing of heart rate as a vagal phenomenon. These data suggest that vagus contributes to severe emotional states and may be related to emotional states of immobilization, such as extreme terror.
|
|
If the fistula cannot be repaired, the clinician may create a permanent diversion of urine or urostomy. Risks associated with the repair of the fistula are also associated with most other surgical procedures and include the risk of adhesions, disorders of wound healing, infection, ileus, and immobilization. There is a recurrence rate of 5%–15% in the surgical operation done to correct the fistula.
|
|
Nosocomial FUO refers to pyrexia in patients that have been admitted to hospital for at least 24 hours. This is commonly related to hospital- associated factors such as surgery, use of a urinary catheter, intravascular devices (i.e. "drip", pulmonary artery catheter), drugs (antibiotic-induced Clostridium difficile colitis, drug fever), and/or immobilization (decubitus ulcers). Sinusitis in the intensive care unit is associated with nasogastric and orotracheal tubes.
|
|
Injured patients can be exposed to shocks and vibrations during transport which can worsen patient conditions due to involuntary motions of the body. Many forms of immobilization devices are used to limit this motion with varying degrees of success. Common modes of patient transport include hand carried stretcher (litter), ground ambulance, and air medical services which all contain multiple forms of shocks and whole-body vibrations.
|
|
Scrambler is a mutant who possesses the ability to disrupt any system with his touch. His touch disrupts systems, whether they be a living being, a machine, or a field of energy. Scrambler must physically touch his target in order to affect it. Scrambler can control the effect so that, in the case of a nervous system, he can cause immobilization, unconsciousness, or seizures.
|
|
Mineralization in soil science is the decomposition (i.e., oxidation) of the chemical compounds in organic matter, by which the nutrients in those compounds are released in soluble inorganic forms that may be available to plants. 384 pages Mineralization is the opposite of immobilization. Mineralization increases the bioavailability of the nutrients that were in the decomposing organic compounds, most notably, because of their quantities, nitrogen, phosphorus, and sulfur.
|
|
In addition, dissolved organic carbon (DOC) affects the soil negative electrical charges denitrification process, acid-base reactions in the soil solution, retention and translocation of nutrients (cations), and immobilization of heavy metals and xenobiotics.Zech, W.; Senesi, N.; Guggenberger, G.; Kaiser, K.; Lehmann, J.; Miano, T.M.; Miltner, A.; Schroth, G. 1997. Factors controlling humification and mineralization of soil organic matter in the tropics. Geoderma 79: 117–161.
|
|
Tonic immobility has been hypothesized to occur in humans undergoing intense trauma, including sexual assault. There is also an increasing body of evidence that points to a positive contribution of tonic immobility in human functioning. Thus, defensive immobilization is hypothesized to have played a crucial role in the evolution of human parent- child attachment, sustained attention and suggestibility, REM sleep and theory of mind.Pdf.
|
|
Lifeguards are proficient in first aid, and have a well stocked first aid kit available. They may have advanced first aid items such as supplemental oxygen, a suction device, a resuscitator, a defibrillator or AED or a spinal immobilization board. Lifeguards are trained to contact EMS personnel immediately. If a drowning victim has been rescued the victim might need EMS attention or extensive medical treatment.
|
|
The company exhibits a wide range of tools related to recombinant protein purification consisting of expression vectors, affinity purification and detection reagents based on its Strep- tag/Strep-Tactin system. This can be used for i.e. drug screening, diagnostic assays, immobilization and interaction studies. Due to its small size and biochemically almost inert character, the Strep-tag does not influence protein folding, secretion and function.
|
|
Another important component to consider in the practice of wholesaling is storage. Storage of goods is one of the characterized aspects of the work of a wholesaler. Wholesaler regulates the deliveries of goods, having synchronized the production and consumption of material goods. Moreover, he, as the wholesaler, further assumes the financial obligations related to the immobilization of funds invested in the creation of commodity stocks.
|
|
Yan (2007), 132. While it was John Milne and Wang Zhenduo who argued early on that Zhang's "central pillar" was a suspended pendulum, Imamura was the first to propose an inverted model.Needham (1986), Volume 3, 628 & 630. He argued that transverse shock would have rendered Wang's immobilization mechanism ineffective, as it would not have prevented further motion that could knock other balls out of their position.
|
|
One of the most popular immobilization methods used is Self-Assembled Monolayer (SAM) on gold surface. Jenkins and collaborators 2001, used mercaptoethanol patches surrounded by SAM composed of octadecanethiol (ODT) to study the adsorption of egg-phosphatidylcholine on the ODT SAM. A pattern of ODT-mercaptoethanol was made onto a 50 nm gold film. The gold film was obtained through thermal evaporation on a LaSFN 9 glass.
|
|
Also, mineral analogues of the ceramic waste forms provide evidence for long term durability.Weber W. J., Navrotsky A., Stefanovsky S., Vance E.R., Vernaz E. Materials Science of High-Level Nuclear Waste Immobilization. MRS Bulletin 2009, 34, 46. Due to this fact and the fact that they can be processed at lower temperatures, ceramics are often considered the next generation in high level radioactive waste forms.
|
|
The initial treatment for both traumatic and degenerative TFCC lesions, with a stable DRUJ, is conservative (nonsurgical) therapy. Patients may be advised to wear a temporary splint or cast to immobilize the wrist and forearm for four to six weeks. The immobilization allows scar tissue to develop which can help heal the TFCC. In addition oral NSAID’s and corticosteroid joint injections can be prescribed for pain relief.
|
|
Physiotherapy and Occupational Therapy can help patients recover after immobilization or surgery. Wrist support straps used in sports can also be used in mild cases to compress and minimize movement of the area. Indications for acute TFCC surgery are: a clearly unstable DRUJ, or the existence of additional unstable or displaced fractures. TFCC surgery is also indicated when conservative treatment proves insufficient in about 8–12 weeks.
|
|
These fractures are the most common of the three groups mentioned above that require surgical management. A minimal articular fracture involves the joint, but does not require reduction of the joint. Manipulative reduction and immobilization were thought to be appropriate for metaphyseal unstable fractures. However, several studies suggest this approach is largely ineffective in patients with high functional demand, and in this case, more stable fixation techniques should be used.
|
|
Presence of antisperm antibodies may be responsible for sperm agglutination, reduced sperm motility, abnormal postcoital test. Several tests are presently available including Sperm Immobilization test, Sperm Agglutination tests, Indirect immunofluorescence test, Enzyme-linked immunosorbent assay, Radiolabelled Antiglobulin Assay. One of the most informative and specific tests is Immunobead Rosette Test which can identify different antibody classes involved (IgG, IgA, IgM) and location on the sperm cell (head, body or tail).
|
|
This is only done on a commercial basis when the need for the product is more justified. Multiple enzymes may be introduced into the reaction, thus eliminating the need for immobilization of multiple enzymes. Furthermore, intracellular enzymes need not be extracted prior to the reaction; they may be used directly. However, some enzymes may be used for the metabolic needs of the cell, leading to reduced yield of the cell.
|
|
Micrograph showing T. pallidum (black and thin) – Dieterle stain T. pallidum was first microscopically identified in syphilitic chancres by Fritz Schaudinn and Erich Hoffmann at the Charité in Berlin in 1905. This bacterium can be detected with special stains, such as the Dieterle stain. T. pallidum is also detected by serology, including nontreponemal VDRL, rapid plasma reagin, treponemal antibody tests (FTA-ABS), T. pallidum immobilization reaction, and syphilis TPHA test.
|
|
In the second phase, the organism executes a locomotor reaction to the phenomenon. Motion towards the source of the stimulus is performed if the stimulus signifies a positive possibility. If the stimulus was evaluated negatively in the first phase, then it is likely that the executed reaction will take the form of escape, fight or immobilization. During the second phase, the organism is primarily occupied by its own actions.
|
|
Paul Randall Harrington (September 27, 1911 – November 29, 1980) was an American orthopaedic surgeon. He is best known as the designer of the Harrington Rod, the first device for the straightening and immobilization of the spine inside the body. It entered common use in the early 1960s and remained the gold standard for scoliosis surgery until the late 1990s. During this period over one million people benefited from Harrington's procedure.
|
|
This might further help in understanding the role of sleep in long term plasticity. According to Tsoukalas (2012), REM sleep is an evolutionary transformation of a well-known defensive mechanism, the tonic immobility reflex. This reflex, also known as animal hypnosis or death feigning, functions as the last line of defense against an attacking predator and consists of the total immobilization of the animal: the animal appears dead (cf. "playing possum").
|
|
A malunion is when a fractured bone doesn’t heal properly. Some ways that it shows is by having the bone being twisted, shorter, or bent. Malunions can occur by having the bones improperly aligned when immobilized, having the cast taken off too early, or never seeking medical treatment after the break. Malunions are painful and commonly produce swelling around the area, possible immobilization, and deterioration of the bone and tissue.
|
|
Alternatively, some authorities argue that therapy should be started later and carried out more cautiously. Theoretically, that gives tissues time to heal; though there is conflicting data regarding the benefits of early immobilization. A study of rats suggested that it improved the strength of surgical repairs, while research on rabbits produced contrary evidence. Individuals with a history of rotator cuff injury, particularly those recovering from tears, are prone to reinjury.
|
|
Continued fighting resulted in the tank's immobilization. The crew stubbornly refused to surrender, so the Germans poured gasoline on it once Naumov had run out of ammunition and set it on fire. The entire crew – Naumov, Smirnov, Noritsyn, Vyalykh, and – were burned to death inside their tank. On 23 September 1943, Naumov was posthumously named a Hero of the Soviet Union by fiat of the Presidium of the Supreme Soviet.
|
|
Cartilage structures and functions can be damaged. Such damage can result from a variety of causes, such as a bad fall or traumatic sport-accident, previous knee injuries or wear and tear over time. Immobilization for long periods can also result in cartilage damage. Articular cartilage damage in the knee may be found on its own but it will more often be found in conjunction with injuries to ligaments and menisci.
|
|
The treatment of choice is an antivenom produced by CSL Ltd in 1956 in Australia on the basis of immunised horse plasma. After being bitten the majority of patients will develop systemic envenoming of which clinical evidence is usually present within two hours. This effect can be delayed by applying first aid measures, like immobilization. Additional to neurotoxins taipan venom contains anticoagulants whose effect is also inhibited by the antivenom.
|
|
Graphene oxide has been demonstrated as a flexible free-standing battery anode material for room temperature lithium-ion and sodium-ion batteries. It is also being studied as a high surface area conducting agent in lithium-sulfur battery cathodes. The functional groups on graphene oxide can serve as sites for chemical modification and immobilization of active species. This approach allows for the creation of hybrid architectures for electrode materials.
|
|
The length of time the scans take can also be an issue, with CT being far quicker. It is also ruled out in patients for whom MRI exams may be unsafe (such as having a pacemaker or metal in the eyes or certain surgical clips). MRA procedures for visualizing cranial circulation are no different from the positioning for a normal MRI brain. Immobilization within the head coil will be required.
|
|
An ECU injury most often requires imaging (CT, MRI, ultrasound) for diagnosis. After the ECU injury is diagnosed, a physician will choose a course of treatment, which depends upon the severity of the injury. Conservative treatments include immobilization and stabilization of the affected wrist by placing it in a cast. A long arm cast may be required in order to ensure that all wrist movement has been stopped.
|
|
Immobilization of the contaminant may occur through sorption to the barrier materials or precipitation from the dissolved state. Organic compounds tend to be undergo sorption due to hydrophobic expulsion from the surrounding water. Metals, however, tend to sorb through electrostatic attraction or surface complexation reactions. Sorption and precipitation are potentially reversible and may thus require removal of the reactive medium and gathered products in order to continue with remediation.
|
|
Pharmacological torture is the use of psychotropic or other drugs to punish or extract information from a person."Pharmacological Torture" World Problems Online. Union of International Associations The aim is to force compliance by causing distress, which could be in the form of pain, anxiety, psychological disturbance, immobilization, or disorientation. One form of this torture involves forcibly injecting a person with addictive drugs in order to induce physical dependence.
|
|
Arousal is a basic physiological response to the presentation of stimuli. When this occurs, a non-conscious affective process takes the form of two control mechanisms; one mobilization, and the other immobilization. Within the human brain, the amygdala regulates an instinctual reaction initiating this arousal process, either freezing the individual or accelerating mobilization. The arousal response is illustrated in studies focused on reward systems that control food-seeking behavior.
|
|
Nanoscale analysis of proteins using atomic force microscopy (AFM) requires surfaces with well-defined topologies and chemistries for many experimental techniques. Biomolecules, particularly proteins, can be immobilized simply on an unmodified substrate surface through hydrophobic or electrostatic interactions. However, several problems are associated with physical adsorption of proteins on surfaces. With metal surfaces, protein denaturation, unstable and reversible binding, nonspecific and random immobilization of protein have been reported.
|
|
Donecle's autonomous drone inspecting an aircraft. Founded in 2015, Donecle, a Toulouse start-up company, has also launched a drone approach which was initially specialized in the detection of lightning strikes on aeroplanes. Performed by five people equipped with harnesses and platforms, this inspection usually takes about eight hours. The immobilization of the aircraft and the staff are costly for the airlines, estimated at $10 000 per hour.
|
|
Head injury may be associated with a neck injury. Bruises on the back or neck, neck pain, or pain radiating to the arms are signs of cervical spine injury and merit spinal immobilization via application of a cervical collar and possibly a longboard. If the neurological exam is normal this is reassuring. Reassessment is needed if there is a worsening headache, seizure, one-sided weakness, or has persistent vomiting.
|
|
To perform measurements for SPRM, the sample preparation is a critical step. There are two factors that can be affected by the immobilization step: one is the reliability and reproducibility of the acquire data. It is important to ensure stability to the recognition element; such as antibodies, proteins, enzymes, under the experiment conditions. Moreover, the stability of the immobilized specimens will affect the sensitivity, and/or the limit of detection (LOD).
|
|
Otherwise the patient is immobilized in maximum extension and casted. This stays on for 10–14 days and a second cast is applied in further extension. After the immobilization the patient is given a protective polyaxial brace, which allows the patient to begin active limited flexion and still keep the full extension. This brace is worn by day and at night the patient wears a semi-firm splint that keeps the arm in maximal extension.
|
|
Correcting this by not tucking the sheets in at the foot of the bed, or by sleeping with the feet hanging off the bed when in the prone position, is part of correcting this imbalance. It occurs also due to muscle tightening for example if after fracture when immobilization is done by putting plaster of paris the muscle length shortens because the muscle is not used for a large span of time.
|
|
Nerve impulses increase the synthesis of PNMT mRNA by affecting certain promoter sequences. Stress immobilization for a few hours has also been shown to increase PNMT activity in rats. This treatment takes about one week to manifest a difference in PNMT levels. SAM not only acts as a cofactor for PNMT, but also helps to stabilize the enzyme and increase the half life by making it more resistant to being cut by trypsin protease.
|
|
To our knowledge the only other species besides the rat that has been involved in spaceflight studies on skeletal muscle is the rhesus monkey. Two monkeys were flown in space for 14 days on the Bion 11 satellite. They were compared to ground-based vivarium control animals as well as a chair- restricted group that involved immobilization of the upper arm and shoulder. The results from these studies provided the following insights.
|
|
They featured improved compartmentalization; propulsion machinery was laid out on the unit system, with alternating groups of boiler rooms and engine rooms, to prevent immobilization by a single torpedo hit. Magazines were the first to be placed on centerline, below the waterline. A serious flaw in these ships' subdivision was the complete lack of watertight bulkheads anywhere above the main deck or aft on the main deck.US Cruisers: An illustrated design history pg.
|
|
The severity of acute syndesmosis injury is rated from grade I to III by several authors. A grade I injury is a partial anteroinferior tibiofibular ligament tear, meaning the exorotation and squeeze tests are negative for this grade. Grade II injury is a complete anteroinferior tibiofibular ligament and inferior interosseous ligament tear, meaning that squeeze test and exorotation are positive. This results in the injury being stabilized with immobilization but not operatively stabilized.
|
|
To Kau Wan () is a bay on the north shore of northeast Lantau Island, Hong Kong. Contaminated soil from Penny's Bay was transferred here for thermal desorption to separate the Volatile Organic Compounds (VOC) and Semi-Volatile Organic Compounds (SVOC) along with cement immobilization of metal contamination from Penny's Bay. The oily residue was transferred to the Chemical Waste Treatment Center (CWTC) in Tsing Yi for incineration (particularly for dioxins and dioxin-like compounds).
|
|
Throughout his life Patchen was a fervent pacifist, as he made clear in much of his work. He was strongly opposed to the involvement of the United States in World War II. In his own words, "I speak for a generation born in one war and doomed to die in another." This controversial view, coupled with his physical immobilization, may have prevented wider recognition or success beyond what some consider a "cult" following.
|
|
Since 2000, of military HEU is displacing about of uranium oxide mine production per year which represents some 13% of world reactor requirements. Plutonium recovered from nuclear weapons or other sources can be blended with uranium fuel to produce a mixed-oxide fuel. In June 2000, the US and Russia agreed to dispose of each of weapons-grade plutonium by 2014. The US undertook to pursue a self-funded dual track program (immobilization and MOX).
|
|
Treatment for patients suffering from posterior cord syndrome depends on the causes and symptoms of the patient, as well as the source of the infraction. The main goal of treatment is to stabilize the spine. Possible treatments include airway adjuncts; the use of ventilators; full spinal precautions and immobilization; and injections of dopamine. While there is no definitive cure for posterior cord syndrome, treatment and supportive care can be provided based on the patient's symptoms.
|
|
The company has worked for the government of the United States of America: Department of energy on their Plutonium Immobilization Project, "After the low pour rate and instrumented canisters cooled, Bluegrass Bit, Inc. used a diamond wire saw to section them at four heights. The sections were then studied for evidence of hardware deformation and glass voids" . This project focused on the finding a way to disposition excess plutonium of a weapons grade classification.
|
|
M-subunit of creatine kinase. In skeletal muscle, creatine kinase exists predominantly in dimers containing two M-subunits, also referred to as "CK-MM". A diagnosis of rhabdomyolysis may be suspected in anyone who has suffered trauma, crush injury or prolonged immobilization, but it may also be identified at a later stage due to deteriorating kidney function (abnormally raised or increasing creatinine and urea levels, falling urine output) or reddish-brown discoloration of the urine.
|
|
Gold nanoparticles are incorporated into biosensors to enhance its stability, sensitivity, and selectivity. Nanoparticle properties such as small size, high surface-to-volume ratio, and high surface energy allow immobilization of large range of biomolecules. Gold nanoparticle, in particular, could also act as "electron wire" to transport electrons and its amplification effect on electromagnetic light allows it to function as signal amplifiers. Main types of gold nanoparticle based biosensors are optical and electrochemical biosensor.
|
|
They also study the nature of cohesive forces through intercellular adhesionCavey, M., Rauzi, M., Lenne, P-F. and Lecuit, T, « A two-tiered mechanism for stabilization and immobilization of E-cadherin », Nature, 2008. 453(7196), p. 751-6 (DOI doi: 10.1038/nature06953)Truong-Quang, BA, Mani M, Markhova O, Lecuit T, Lenne PF, « Principles of E-cadherin supramolecular organization in vivo », Current Biology, 2013 nov 18;23(22), p. 2197-207 (DOI doi: 10.1016/j.cub.2013.09.015).
|
|
Diopside based ceramics and glass-ceramics have potential applications in various technological areas. A diopside based glass-ceramic named 'silceram' was produced by scientists from Imperial College, UK during the 1980s from blast furnace slag and other waste products. They also produced glass-ceramic is a potential structural material. Similarly, diopside based ceramics and glass-ceramics have potential applications in the field of biomaterials, nuclear waste immobilization and sealing materials in solid oxide fuel cells.
|
|
On May 11, 2011, four days after scoring six touchdowns for the Slaughter, Grady was sentenced to twenty days in jail for his November drunk driving offense. The sentence included two years of probation, 80 hours of community service, random drug tests, confinement to the state of Michigan until given leave by the judge, and 180 days of car immobilization. In addition, the sentence resulted in him being dropped from the Slaughter.
|
|
Policing may involve oophagy and immobilization of egg-layers from the worker caste. In some ant species such as the carpenter ant Camponotus floridanus, eggs from queens have a peculiar chemical profile that workers can distinguish from worker laid eggs. When worker-laid eggs are found, they are eaten. In some species, such as Pachycondyla obscuricornis, workers may try to escape policing by shuffling their eggs within the egg pile laid by the queen.
|
|
Approximately 3.7 male hand injuries, per 1000, per year, and 1.3 female hand injuries, per 1000, per year, have been reported. Common mechanisms of injury are gender specific. Although the fiscal cost is not available, it can be asserted that the cost is reasonably significant per individual, depending on the cost of emergency care, immobilization, surgery, follow up doctors’ visits, etc. in addition to the fiscal impact from loss of and/or limited work abilities.
|
|
No heterogeneous catalyst has been commercialized for asymmetric hydrogenation. The first asymmetric hydrogenation focused on palladium deposited on a silk support. Cinchona alkaloids have been used as chiral modifiers for enantioselectivity hydrogenation. Cinchonidine, one of the cinchona alkaloids An alternative technique and one that allows more control over the structural and electronic properties of active catalytic sites is the immobilization of catalysts that have been developed for homogeneous catalysis on a heterogeneous support.
|
|
Flow-induced dispersion analysis (FIDA), is a new capillary-based and immobilization-free technology used for characterization and quantification of biomolecular interaction and protein concentration under native conditions. The technique is based on measuring the change in apparent size (hydrodynamic radius) of a selective ligand when interacting with the analyte of interest. A FIDA assay works in complex solutions (e.g. plasma ), and provides information regarding analyte concentration, affinity constants, molecular size and binding kinetics.
|
|
Candidates for non-operative treatment are limited to skeletally immature teenagers with a relatively small, intact lesion and the absence of loose bodies. Non-operative management may include activity modification, protected weight bearing (partial or non-weight bearing), and immobilization. The goal of non-operative intervention is to promote healing in the subchondral bone and prevent potential chondral collapse, subsequent fracture, and crater formation. Once candidates for treatment have been screened, treatment proceeds according to the lesion's location.
|
|
Polyvagal theory claims that human facial expressions are associated with, or reflect, physical reactions, such as cardiac and digestive changes. Porges argues this theory with observations from both evolutionary biology and neurology. The branches of the vagal nerve are claimed to serve different evolutionary stress responses in mammals: the more primitive branch is said to elicit immobilization behaviors (e.g., feigning death), whereas the more evolved branch is said to be linked to social communication and self-soothing behaviors.
|
|
EM Microelectronic's products include RFID circuits, smart cards ICs, ultra-low power microcontrollers, power management, LCD drivers and displays, sensor and opto-electronic ICs, mixed-mode arrays and standard analog ICs. EM manufacture not only standard circuits and ASICs, but also systems and modules for applications such as access control, radio frequency identification, mobile phones, mass-market consumer appliances, alarm and security systems, utility and heating meters, sensor signal processing, controlling, car immobilization, electronic automotive subsystems and many more.
|
|
Basically, three traditional methods of enzyme immobilization can be distinguished: binding to a support(carrier), entrapment (encapsulation) and cross-linking. Support binding can be physical, ionic, or covalent in nature. However, physical bonding is generally too weak to keep the enzyme fixed to the carrier under industrial conditions of high reactant and product concentrations and high ionic strength. The support can be a synthetic resin, a biopolymer or an inorganic polymer such as (mesoporous) silica or a zeolite.
|
|
Flow-induced dispersion analysis (FIDA) is an immobilization-free technology used for characterization and quantification of biomolecular interaction and protein concentration under native conditions. In the FIDA assay, the size of a ligand (indicator) with affinity to the target analyte is measured. When the indicator interacts with the analyte the apparent size increases and this change in size can be used to determine the analyte concentration and interaction. Additionally, the hydrodynamic radius of the analyte-indicator complex is obtained.
|
|
The LD50 of LNTX-1 is determined at 0,51 mg/kg by intravenous injection of the venom in mice. The IC50 value for LNTX-1 is 0,763 μM when the toxin is applied to human cells. The binding of LNTX-1 to the acetylcholine receptors leads to a loss of function in neuronal and neuromuscular transmission. The resulting symptoms include immobilization and asphyxiation which can be lethal to the subject that is infected by the toxin.
|
|
The door is locked but suddenly opens and Phoebe is guided to a wooden chest. Opening the chest, she discovers a large, ancient book called the Book of Shadows. Unaware of the powers involved, but overcome with curiosity, she reads a page aloud, which mentions three sisters and the power of three having the active powers of an ancestor named Melinda Warren. The spell bestows Phoebe with premonitions, Piper with molecular immobilization, and Prue with telekinesis.
|
|
To get Colette to the hospital in Saskatoon in time, 40-50 vehicles in Porcupine Plain shone their headlights on the plane strip landing so the air ambulance could land. The accident punctured her lungs, broke her sternum and back. 98% of her spine was severed and two Harrington rods were placed in her back to maintain the curvature of her back. Bourgonje admitted her immobilization to her uncle Don, who was instructed by Colette to tell everyone else.
|
|
Fractures of the scaphoid are the most common of the carpal bone injuries, because of its connections with the two rows of carpal bones. The scaphoid can be slow to heal because of the limited circulation to the bone. Fractures of the scaphoid must be recognized and treated quickly, as prompt treatment by immobilization or surgical fixation increases the likelihood of the bone healing in anatomic alignment, thus avoiding mal-union or non-union. Delays may compromise healing.
|
|
DTT is used as a reducing or "deprotecting" agent for thiolated DNA. The terminal sulfur atoms of thiolated DNA have a tendency to form dimers in solution, especially in the presence of oxygen. Dimerization greatly lowers the efficiency of subsequent coupling reactions such as DNA immobilization on gold in biosensors. Typically DTT is mixed with a DNA solution and allowed to react, and then is removed by filtration (for the solid catalyst) or by chromatography (for the liquid form).
|
|
Those with pain but reasonably maintained function are suitable for nonoperative management. This includes medications that provide pain relief such as anti-inflammatory agents, topical pain relievers such as cold packs, and if warranted, subacromial corticosteroid or local anesthetic injection. Topical glyceryl trinitrate appears effective at relieving acute symptoms however, headaches were reported as a side effect. A sling may be offered for short-term comfort, with the understanding that undesirable shoulder stiffness can develop with prolonged immobilization.
|
|
Blood alterations including dysfibrinogenemia, low free protein S, activated protein C resistance, homocystinuria, hyperhomocysteinemia, high fibrinogen levels, high factor IX levels, and high factor XI levels are associated with increased risk. Some risk factors influence the location of DVT within the body. In isolated distal DVT, the profile of risk factors appears distinct from proximal DVT. Transient factors, such as surgery and immobilization, appear to dominate, whereas thrombophilias and age do not seem to increase risk.
|
|
Enzyme immobilization in hydrogels is a fairly well-established process. Reversibly cross-linked polymer networks and hydrogels can be similarly applied to a biological system where the response and release of a drug is triggered by the target molecule itself. Alternatively, the response might be turned on or off by the product of an enzyme reaction. This is often done by incorporating an enzyme, receptor or antibody, that binds to the molecule of interest, into the hydrogel.
|
|
The effect is thus to improve the plant's mineral absorption capabilities. Unaided plant roots may be unable to take up nutrients that are chemically or physically immobilised; examples include phosphate ions and micronutrients such as iron. One form of such immobilization occurs in soil with high clay content, or soils with a strongly basic pH. The mycelium of the mycorrhizal fungus can, however, access many such nutrient sources, and make them available to the plants they colonize.
|
|
However, 80% of hostages taken by insurgents have been peacefully released. Jill Carroll, a journalist for the Christian Science Monitor, was kidnapped in early 2006, and although later let go, her Iraqi interpreter was killed. The goal of the kidnappings appears mainly to be to terrify foreign civilians into immobilization and to attract media attention and possibly inspire recruits. Almost all of the kidnappings have been conducted by radical Sunni groups on the fringe of the insurgency.
|
|
The muscle damage is most often the result of a crush injury, strenuous exercise, medications, or drug abuse. Other causes include infections, electrical injury, heat stroke, prolonged immobilization, lack of blood flow to a limb, or snake bites. Some people have inherited muscle conditions that increase the risk of rhabdomyolysis. The diagnosis is supported by a urine test strip which is positive for "blood" but the urine contains no red blood cells when examined with a microscope.
|
|
Viperids use this mechanism primarily for immobilization and digestion of prey. Pre-digestion occurs as the venom contains proteases which degrade tissues. Secondarily, it is used for self-defense, though in cases with non-prey, such as humans, they may give a dry bite (not inject any venom). A dry bite allows the snake to conserve its precious reserve of venom, because once it has been depleted, it takes time to replenish, leaving the snake vulnerable.
|
|
In children, the most common form of venous access is also peripheral access although the dwell time in children are much shorter than in adults, 1-4 days. Accessing veins in the legs in children can promote immobilization, but is used if there are no other way. In neonates, scalp veins can also be used if other peripheral veins are not accessible. Umbilical veins are also an option in neonates, but is per definition a central access.
|
|
If the C:N ratio of the decomposing plant material is above about 30:1 the soil microbial population may take nitrogen in mineral form (e.g. nitrate). This mineral nitrogen is said to be immobilized. Microorganisms out-compete plants for NH4+ and NO3- during immobilization, and therefore plants can easily become nitrogen deficient. As carbon dioxide is released via decomposition the C:N ratio of the organic matter decreases, and the microbial demand for mineral nitrogen is decreased.
|
|
Over a six-week period, Earth-based physical simulations were performed to decide how best to extract the rover from its position without risking its permanent immobilization. Successful maneuvering a few centimeters at a time eventually freed the rover, which resumed its travels. Opportunity was directed to proceed in a southerly direction to Erebus crater, a large, shallow, partially buried crater and a stopover on the way south towards Victoria crater, between October 2005 and March 2006.
|
|
Several reports have indicated the active roles played by the cytoskeleton in inhibiting or enabling the redistribution/clustering of membrane molecules. Receptor monomers can hop across the inter-compartment boundaries quite readily, but when they form oligomers, their size increases and consequently their hop rate decreases dramatically. Many receptors and other membrane-associated molecules are temporarily immobilized on actin filaments. This immobilization is often enhanced upon receptor engagement, and constitutes a key step for recruiting the downstream signaling molecule.
|
|
Every year there are thousands of reports of bear sightings and nuisance bear complaints. During winter months hibernating bears are located and data regarding population, health and the number of cubs with sows is gathered. In addition to black bears, Connecticut has a growing moose population. EnCon Police Officers assigned to the Chemical Immobilization team are experienced at tranquilizing and relocating moose as well as bear and deer from urban to rural areas of the state.
|
|
There is little high quality evidence for spinal motion stabilization of the neck before arrival at a hospital. Using a hard cervical collar and attaching a person to an EMS stretcher may be sufficient in those who were walking after the accident or during long transports. In those with penetrating neck or head trauma spinal immobilization may increase the risk of death. If intubation is required the cervical collar should be removed and inline stabilization provided.
|
|
DPI provides real-time, high- resolution measurements of molecular size, density and mass. While tagging is not necessary, one of the protein species must be immobilized on the surface of a waveguide. As well as kinetics and affinity, conformational changes during interaction can also be quantified. Static light scattering (SLS) measures changes in the Rayleigh scattering of protein complexes in solution and can characterize both weak and strong interactions without labeling or immobilization of the proteins or other biomacromolecule.
|
|
Some alternative procedures describe unspecific covalent binding and adhesive immobilization. However, lithographic methods can be used to overcome the problem of excessive number of coupling cycles. Combinatorial synthesis of peptide arrays onto a microchip by laser printing has been described, where a modified colour laser printer is used in combination with conventional solid- phase peptide synthesis chemistry. Amino acids are immobilized within toner particles, and the peptides are printed onto the chip surface in consecutive, combinatorial layers.
|
|
English- Yugoslav Hospital for Treatment of Osteoarticular Tuberculosis was officially opened on September 23, 1934, under the auspices of Her Majesty Queen Maria Karađorđević. The first patients were transferred from a Belgrade hospital as early as August 1. The treatment was focused on patients suffering from tuberculosis of the bones and joints, rachitis. The treatment consisted of fresh air, sun exposure, good food, rest, massage, immobilization with plaster and surgery if there was a need for it.
|
|
The idea behind TAPPIR is to use the advantages posed by SIRs, namely low extractant loss due to immobilization in the pores and less emulsification than in liquid-liquid extraction. This way, the drawbacks of ATPE could be remedied. The setup would consist of a packed column or a fluidized bed rather than liquid-liquid extraction equipment with additional phase separation steps. Nonetheless, as yet only first feasibility studies are on the way to prove the concept.
|
|
Conservative treatment relies on immobilizing the knee in full extension to allow the stretched or torn ligaments to heal. It is imperative that the patient keep the knee immobilized and not bear weight on the joint for 3 to 4 weeks to allow sufficient time for the structures to heal. Following immobilization, the patient can begin exercises to improve range of motion and begin bearing weight on crutches only. The crutches can be discontinued when the patient can walk without limping.
|
|
According to Tsoukalas (2012) REM sleep is an evolutionary transformation of a well-known defensive mechanism, the tonic immobility reflex. This reflex, also known as animal hypnosis or death feigning, functions as the last line of defense against an attacking predator and consists of the total immobilization of the animal: the animal appears dead (cf. "playing possum"). Tsoukalas claims that the neurophysiology and phenomenology of this reaction shows striking similarities to REM sleep, a fact that suggests a deep evolutionary kinship.
|
|
Trim63/MuRF1 has been shown to be an E3 ubiquitin ligase. Its major substrate is Myosin Heavy Chain. MuRF1 is upregulated during skeletal muscle atrophy – and thus the degradation of myosin heavy chain, which is a major component of the sarcomere, is an important mechanism in the breakdown of skeletal muscle under atrophy conditions. MuRF1 has been shown to be upregulated during denervation, administration of glucocorticoids, immobilization, and casting (when a cast is applied to a limb, in order to immoblize it).
|
|
These are used in bioremediation as well as in bio-prospecting, The Institute has demonstrated rejuvenation of mine spoil dumpsites and continue to develop additional expertise through an integrated biotechnological approach for detoxification of degraded lands. The technology for solidification / stabilization and immobilization of arsenic bearing hazardous wastes was implemented in Zuari Industries Ltd., Goa. The Institute was involved in providing solutions to some of the pollution problems due to industrial and municipal wastewater discharge in places such as Delhi and Tirupur.
|
|
In the absence of tillage, and in soils with depleted organic matter, crops with large root systems may build up organic matter to the point that nearly all of the soil nitrogen and phosphorus is immobilized. When this happens, productivity may decline until either the organic matter builds up to a level where equilibrium is reached between nutrient mineralization and nutrient immobilization or fertilizer is added to the system. # Hydrological impacts. Perennial plants may intercept and utilize more of the incoming rainfall.
|
|
In many cases, individuals with CCS can experience a reduction in their neurological symptoms with conservative management. The first steps of these intervention strategies include admission to an intensive care unit (ICU) after initial injury. After entering the ICU, early immobilization of the cervical spine with a neck collar would be placed on the patient to limit the potential of further injury. Cervical spine restriction is maintained for approximately six weeks until the individual experiences a reduction in pain and neurological symptoms.
|
|
In studies, neurotrophic factors are normally used in conjunction with other techniques such as biological and physical cues created by the addition of cells and specific topographies. The neurotrophic factors may or may not be immobilized to the scaffold structure, though immobilization is preferred because it allows for the creation of permanent, controllable gradients. In some cases, such as neural drug delivery systems, they are loosely immobilized such that they can be selectively released at specified times and in specified amounts.
|
|
ConA interacts with the surface mannose residues of many microbes, including the bacteria E. coli, and Bacillus subtilis and the protist Dictyostelium discoideum. It has also been shown as a stimulator of several matrix metalloproteinases (MMPs). ConA has proven useful in applications requiring solid-phase immobilization of glycoenzymes, especially those that have proved difficult to immobilize by traditional covalent coupling. Using ConA-couple matrices, such enzymes may be immobilized in high quantities without a concurrent loss of activity and/or stability.
|
|
An adaptation of stationary phase for a separation problem is possible by a specific modification of the surface of the porous glass. In biotechnology, porous glasses have benefits for the cleaning of DNA and the immobilization of enzymes or microorganisms. Controlled pore glass (CPG) with pore sizes between 50 and 300 nm is also excellently suited for the synthesis of oligonucleotides. In this application, a linker, a nucleoside or a non- nucleosidic compound, is first attached to the surface of CPG.
|
|
Bacteriophage derived proteins are used for detection and removal of bacteriaKretzer JW, Lehmann R, Banz M, Kim KP, Korn C. Loessner MJ (2007) Use of high affinity cell wall-binding domains of bacteriophage endolysins for immobilization and separation of bacterial cells. Appl Environ Microbiol 73:1992-2000Rozand, C., Feng, P. C. H. (2009). Specificity analysis of a novel phage-derived ligand in an Enzyme-linked fluorescent assay for detection of Escherichia coli O157:H7. J. food protection 72, 1078-1081.
|
|
No difference in functional outcome has been reported between the two types of immobilization. Current practice for simple fractures without great displacement is generally to provide a sling, and pain relief, and to allow the bone to heal itself, monitoring progress with X-rays every week or few weeks if necessary. Surgery is employed in 5–10% of cases. However, a meta- analysis of 2 144 midshaft clavicle fractures supports primary plate fixation of completely displaced midshaft clavicular fractures in active adult patients.
|
|
Namiki supplies industrial jewel parts such as jewel bearings, diamond cantilevers, watch exterior parts, and sapphire wafers which are made of synthetic sapphire which is produced in-house. They have developed sapphire step wafers, with a step height of 0.22 nanometres, which are expected to become the height standard for scanning probe microscopy (SPM), plus Immobilization plates for observing bio-materials.Control of Nano-Step Structures on Sapphire Wafer Surface by Focused Ion Beam Processing (in Japanese). National Institute of Informatics.
|
|
Among the treatments are closing wounds with sutures (for wounds of the lip, throat, and shoulder), bandaging, splints, poultices, preventing and curing infection with honey, and stopping bleeding with raw meat. Immobilization is advised for head and spinal cord injuries, as well as other lower body fractures. The papyrus also describes realistic anatomical, physiological and pathological observations. It contains the first known descriptions of the cranial structures, the meninges, the external surface of the brain, the cerebrospinal fluid, and the intracranial pulsations.
|
|
The hydrodynamic radius is the radius of a solid sphere with the same translational diffusion coefficient as that measured for the sample particle. As proteins associate, the average hydrodynamic radius of the solution increases. Application of the Method of Continuous Variation, otherwise known as the Job plot, with the solution hydrodynamic radius as the observable, enables in vitro determination of Kd, complex stoichiometry, complex hydrodynamic radius, and the ΔH° and ΔS° of protein–protein interactions. This technique does not entail immobilization or labeling.
|
|
MICP is a promising technique that can be used for containment of various contaminants and heavy metals. The availability of lead in soil may reduced by its chelation with the MICP product, which is the mechanism responsible for Pb immobilization. MICP can be also applied to achieve sequestration of heavy metals and radionuclides. Microbially induced calcium carbonate precipitation of radionuclide and contaminant metals into calcite is a competitive co- precipitation reaction in which suitable divalent cations are incorporated into the calcite lattice.
|
|
Muscle atrophy is the loss of skeletal muscle mass that can be caused by immobility, aging, malnutrition, medications, or a wide range of injuries or diseases that impact the musculoskeletal or nervous system. Muscle atrophy leads to muscle weakness and causes disability. Disuse causes rapid muscle atrophy and often occurs during injury or illness that requires immobilization of a limb or bed rest. Depending on the duration of disuse and the health of the individual, this may be fully reversed with activity.
|
|
Speaking casually, it does not move in relation to the stars and galaxies; it does not rotate. Determining perfect immobilization of direction is not possible in practice, but we can get much closer than it is even possible for us to measure. The more distant an object is, the less its direction appears to move in relation to us (the parallax effect). The ICRF thus uses very distant objects, well outside our galaxy, to establish its directional points of reference.
|
|
Even the courtyard was fenced and decorated like a park. The orchard and vineyard were also located within the yard. The principle treatment of bone and joint tuberculosis at the time when antibiotics and antituberculotics did not exist consisted of increasing the general resistance of patients with hygienic and dietary regimen, fresh air therapy, heliotherapy (exposure to the sun during the day, during the winter exposure to artificial light), immobilization and various surgical procedures. Special attention was also paid to hospital hygiene.
|
|
In the absence of tillage, and in soils with depleted organic matter, crops with large root systems may build up organic matter to the point that nearly all of the soil nitrogen and phosphorus is immobilized. When this happens, productivity may decline until either the organic matter builds up to a level where equilibrium is reached between nutrient mineralization and nutrient immobilization or fertilizer is added to the system. # Hydrological impacts. Perennial plants may intercept and utilize more of the incoming rainfall.
|
|
Although still susceptible to infection, it is more resistant to parasites than other local snakes, allowing it to survive exclusively on lizards. The severity of its venom depends on the susceptibility of the victim, it is capable of fully paralyzing small reptiles and rodents rendering them helpless for consumption, but in humans its effects ranges from mild swelling to immobilization and severe numbness that may last up to a month. No fatalities have been reported from the bite of a Puerto Rican racer.
|
|
Durations of primary and secondary fermentation producing satisfactory mead may vary considerably according to numerous factors, such as floral origin of the honey and its natural sugar and microorganism contents, must water percentage, pH, additives used, and strain of yeast, among others. Although supplementation of the must with non-nitrogen based salts, or vitamins has been tested to improve mead qualities, no evidence suggests that adding micronutrients reduced fermentation time or improved quality. Cell immobilization methods, however, proved effective for enhancing mead quality.
|
|
Bioaugmentation is the introduction of more archaea or bacterial cultures to enhance the contaminant degradation whereas biostimulation is the addition of nutritional supplements for the indigenous bacteria to promote the bacterial metabolism. If the indigenous variety do not have the metabolic capability to perform the remediation process, exogenous varieties with such sophisticated pathways are introduced. The utilization of bioaugmentation provides advancement in the fields of microbial ecology and biology, immobilization, and bioreactor design. Bioaugmentation is commonly used in municipal wastewater treatment to restart activated sludge bioreactors.
|
|
However, CLECs have an inherent disadvantage: enzyme crystallization is a laborious procedure requiring enzyme of high purity, which translates to prohibitively high costs. The more recently developed cross-linked enzyme aggregates (CLEAs), on the other hand, are produced by simple precipitation of the enzyme from aqueous solution, as physical aggregates of protein molecules, by the addition of salts, or water miscible organic solvents or non-ionic polymers.Sheldon, R.A.; Schoevaart, R.; van Langen, L.; A novel method for enzyme immobilization; Biocat. Biotrans, 2005, 23(3/4), 141-147.
|
|
A second, more recent evolution extrapolates the original concept of stereotactic radiosurgery to extra-cranial targets, most notably in the lung, liver, pancreas, and prostate. This treatment approach, entitled stereotactic body radiotherapy or SBRT, is challenged by various types of motion. On top of patient immobilization challenges and the associated patient motion, extra-cranial lesions move with respect to the patient's position due to respiration, bladder and rectum filling. Like stereotactic radiosurgery, the intent of stereotactic body radiotherapy is to eradicate a defined extra-cranial target.
|
|
Tree species used for the immobilization of the moving sand include black locust, black pine, Scots pine and various deciduous species. A total of 200 animal species inhabits the sands. Rare fauna include the desert ant, antlion, mole rat, steppe polecat, and Southern birch mouse. The main source of food for some endangered birds of prey, such as the saker falcon, eastern imperial eagle and lesser spotted eagle, are ground squirrels that live in large open grass fields; hence such areas are necessary for their survival.
|
|
After the war, numerous Youth work actions were organized in the sands. Until the late 1980s, organized and planned works included immobilization of the sand, formation of the firefighting paths and paving the roads, while the "Čardak" settlement for the participants of the actions was constructed. It was envisioned as a touristic and sports complex in the future, but it was neglected in time and since the 1990s became a settlement for the Yugoslav wars refugees. "Čardak" was then adapted into the educational-recreational center.
|
|
However, there are symptoms that can be modeled in a lab setting, one of which is stress induced immobilization. If a rodent is subjected to the short term inescapable stress of being suspended in the air it will develop an immobile posture. If antidepressant agents are administered before the test, the animal will struggle for a longer period of time than if not. Immobility in the TST is defined as when the animal doesn’t want to put in the effort to try to escape.
|
|
Probes are usually prepared by introduction of chemically active groups in terminal position of the oligonucleotides during their synthesis. Probes for immobilization are transferred into gel elements of micromatrix by using dispensing robots. The fibre-optic pin of the robots has a hydrophobic side surface and a hydrophilic tip, and operates at a dew temperature to prevent evaporation of the sample during transfer. The activated probes are chemically immobilized by coupling oligonucleotides bearing amino or aldehyde groups with gel supports containing aldehyde or amino groups respectively.
|
|
The etiology of the Galeazzi fracture is thought to be a fall that causes an axial load to be placed on a hyperpronated forearm. However, researchers have been unable to reproduce the mechanism of injury in a laboratory setting. After the injury, the fracture is subject to deforming forces including those of the brachioradialis, pronator quadratus, and thumb extensors, as well as the weight of the hand. The deforming muscular and soft- tissue injuries that are associated with this fracture cannot be controlled with plaster immobilization.
|
|
Gypsum from New South Wales, AustraliaAlthough these bandages were an improvement over Larrey's method, they were far from ideal. They required a long time to apply and dry and there was often shrinkage and distortion. A great deal of interest had been aroused in Europe around 1800 by a British diplomat, consul William Eton, who described a method of treating fractures that he had observed in Turkey. He noted that gypsum plaster (plaster of Paris) was moulded around the patient's leg to cause immobilization.
|
|
Caputo RP, Simons A, Giambartolomei A, Grant W, Fedele K, Abraham S, Reger MJ, Walford GD, Esente P. Transradial cardiac catheterization in elderly patients. Catheterization and Cardiovascular Interventions 2000; 51: 287-290 As after catheterization through femoral approach patient is generally required to lay flat with immobilization of the leg for 4– 6 hours. Early ambulation and early discharge after transradial catheterization improves quality of life and reduces morbidity. Both patients and hospital staff typically strongly prefer the transradial approach as opposed to femoral access.
|
|
Occasionally smaller bones, such as phalanges of the toes and fingers, may be treated without the cast, by buddy wrapping them, which serves a similar function to making a cast. A device called a Suzuki frame may be used in cases of deep, complex intra- articular digit fractures. By allowing only limited movement, immobilization helps preserve anatomical alignment while enabling callus formation, toward the target of achieving union. Splinting results in the same outcome as casting in children who have a distal radius fracture with little shifting.
|
|
Men may develop an enlargement of breast tissue, known as gynecomastia, testicular atrophy, and a reduced sperm count. The androgenic:anabolic ratio of an AAS is an important factor when determining the clinical application of these compounds. Compounds with a high ratio of androgenic to an anabolic effects are the drug of choice in androgen-replacement therapy (e.g., treating hypogonadism in males), whereas compounds with a reduced androgenic:anabolic ratio are preferred for anemia and osteoporosis, and to reverse protein loss following trauma, surgery, or prolonged immobilization.
|
|
It starts with the spotting and immobilization of an array of DNA templates onto a glass slide. The slide is then assembled face-to-face with a second slide pre-coated with a protein-capturing reagent, and a membrane soaked with cell extract is placed between the two slides for transcription and translation to take place. The newly synthesized his-tagged proteins are then immobilized onto the slide to form the array. In the publication in 18 of 20 replications a protein microarray copy could be generated.
|
|
Typical effects of non-lethal weaponry include stamina depletion, target immobilization and information manipulation. Support items are the most diverse in realizing these goals. Stun grenades, for instance, deplete the stamina of nearby opponents, but also cause temporary blindness and deafness to targets up to medium distance. Other examples include proximity and trigger activated sleepgas mines, e-locators that disclose the position of close by targets, chaff grenades to both limit visibility and temporarily obscure the SOP radar, and magazines that occupy a target, rendering them immobile.
|
|
The pre-hospital setting provides unique challenges to management of the airway including tight spaces, neck immobilization, poor lighting, and often the added complexity of attempting procedures during transport. When possible, basic airway management should be prioritized including head-tilt-chin-lift maneuvers, and bag-valve masking. If ineffective, a supraglottic airway can be utilized to aid in oxygenation and maintenance of a patent airway. An oropharyngeal airway is acceptable, however nasopharyngeal airways should be avoided in trauma, particularly if a basilar skull fracture is suspected.
|
|
The enzymes in sugar battery are no more fixed to the electrode, nor entrapped in a limited space near the electrode. The enzymes in the sugar battery can move freely in a larger space and retain the enzymatic activity. To sustain high-speed mass transfer, the researchers immobilized vitamin K3 to the electrode. The corresponding experiments suggest that the non-immobilization method helps the sugar battery to reach a higher and more stable energy density level than the regular enzyme fuel cells with immobilized enzymes.
|
|
While the bone formation usually spans the entire duration of the healing process, in some instances, bone marrow within the fracture has healed two or fewer weeks before the final remodeling phase. While immobilization and surgery may facilitate healing, a fracture ultimately heals through physiological processes. The healing process is mainly determined by the periosteum (the connective tissue membrane covering the bone). The periosteum is one source of precursor cells which develop into chondroblasts and osteoblasts that are essential to the healing of bone.
|
|
A meta-analysis found that creatine treatment increased muscle strength in muscular dystrophies, and potentially improved functional performance. Creatine treatment does not appear to improve muscle strength in people who have metabolic myopathies. High doses of creatine lead to increased muscle pain and an impairment in activities of daily living when taken by people who have McArdle disease. According to a clinical study focusing on people with various muscular dystrophies, using a pure form of creatine monohydrate can be beneficial in rehabilitation after injuries and immobilization.
|
|
Spiders will defend themselves and without an immobilization agent are difficult to parasitize. Mortality rates are highest in the egg and larval stages of the parasitoid wasp as well so they may die before they get the chance to finish their lifecycle. Also unless they are able successfully camouflage or protect themselves, predators in the environment can take advantage and kill them as well. With its parasitoid lifecycle taking a great deal of time, there is much that could go wrong resulting in mortality.
|
|
Utilizing their saw as an extended sensing device, sawfish are able to "view" their entire surroundings by maintaining a position low to the sea floor. Sawfish uncover sand dwelling crustaceans and mollusks, two common prey types, by using their unique anatomical structure as a tool for digging and grubbing about in sand or mud. The sawfish churn up the sea bottom with their exaggerated rostrum to uncover these hidden food sources. It is believed that the elongated rostrum first evolved for its use in prey immobilization.
|
|
The two robot lovers carry their creators in hopes to get them to safety, but end up locking up when they run into a 'rust storm.' The immobilization of the two robots causes their creators to carry them out of harm's way. The rust storm also claims Sparepartski, who it is then revealed was a giant scrap concoction created and operated by Gizmo. Gizmo reveals his love for machines, and after seeing Julie-8 at the robotics convention, wanted to make her his bride.
|
|
Monsan was educated at INSA Toulouse and the University of Toulouse where he graduated with an engineer degree (Ingénieur diplômé) in Biological Chemistry in 1969. He was then awarded his Doctor-Engineer Degree in 1971 and his PhD degree in 1977 from INSA Toulouse for research on enzyme immobilization. He served as lecturer in the Department of Biochemical Engineering at INSA Toulouse from 1969 and was later promoted to Assistant Professor (1973) and then Professor (1981). In 1984, Monsan took a leave from Academia and co- founded BioEurope, a startup company specialized in industrial biocatalysis.
|
|
Muscle atrophy may also result from the natural aging process or from disease. In humans, prolonged periods of immobilization, as in the cases of bed rest or astronauts flying in space, are known to result in muscle weakening and atrophy. Atrophy is of particular interest to the manned spaceflight community, because the weightlessness experienced in spaceflight results is a loss of as much as 30% of mass in some muscles. Such consequences are also noted in small hibernating mammals like the golden-mantled ground squirrels and brown bats.
|
|
The Edmonton protocol involves implantation of human islets extracted from cadaveric donors and has shown improvements towards the treatment of type 1 diabetics who are prone to hypoglycemic unawareness. However, the two major hurdles faced in this technique are the limited availability of donor organs and with the need for immunosuppresents to prevent an immune response in the patient's body. Several studies have been dedicated towards the development of bioartificial pancreas involving the immobilization of islets of Langerhans inside polymeric capsules. The first attempt towards this aim was demonstrated in 1980 by Lim et al.
|
|
Moreover, immobilization of an enzyme on a carrier often leads to a substantial loss of activity, especially at high enzyme loadings. Consequently, there is an increasing interest in carrier-free immobilized enzymes, such as cross-linked enzyme crystals (CLECs) and cross- linked enzyme aggregates (CLEAs) that offer the advantages of highly concentrated enzyme activity combined with high stability and low production costs owing to the exclusion of an additional (expensive) carrier. Cao, L.; van Langen, L.; Sheldon, R.A.; Immobilised enzymes: carrier-bound of carrier- free?; Curr. Opin. Biotechnol.
|
|
See Homologous competitive binding curves , A complete guide to nonlinear regression, curvefit.com. Real-time based methods, which are often label-free, such as surface plasmon resonance, dual- polarization interferometry and multi-parametric surface plasmon resonance (MP-SPR) can not only quantify the affinity from concentration based assays; but also from the kinetics of association and dissociation, and in the later cases, the conformational change induced upon binding. MP-SPR also enables measurements in high saline dissociation buffers thanks to a unique optical setup. Microscale thermophoresis (MST), an immobilization-free method was developed.
|
|
It is generally told to children, and not commonly believed anymore by adults. In the verse in Simple Simon (above), the point is made even then only a simpleton would believe the legend. Salting of a bird's tail has been used by analogy as an idiom for immobilization of persons since at least the 19th century, by writers such as Walter Scott, Robert Burns, Walter Lantz, John Phillips, and others. "Ye'll ne'er cast saut on his tail" (English: You'll never cast salt on his tail) is a Scottish proverb of unknown antiquity.
|
|
56: Global Change: Effects on Coniferous Forests and Grasslands Carbon Budget, Ch. 3. (1996). Litterfall is the dominant pathway for nutrient return to the soil, especially for nitrogen (N) and phosphorus (P). The accumulation of these nutrients in the top layer of soil is known as soil immobilization. Once the litterfall has settled, decomposition of the litter layer, accomplished through the leaching of nutrients by rainfall and throughfall and by the efforts of detritivores, releases the breakdown products into the soil below and therefore contributes to the cation exchange capacity of the soil.
|
|
The evolutionary origin of theory of mind remains obscure. While many theories make claims about its role in the development of human language and social cognition few of them specify in detail any evolutionary neurophysiological precursors. A recent theory claims that Theory of Mind has its roots in two defensive reactions, namely immobilization stress and tonic immobility, which are implicated in the handling of stressful encounters and also figure prominently in mammalian childrearing practices (Tsoukalas, 2018).Pdf. Their combined effect seems capable of producing many of the hallmarks of theory of mind, e.g.
|
|
This can result in immobilization or worse for the victim of the attack. To an observer who witnesses a person trumping to another location, the person becomes two- dimensional before disappearing, and there is a prismatic aftereffect. In Trumps of Doom, Merlin also mentions sensing a kind of electrical charge as Jasra trumps into a room where he waits. Further details about the nature of Trumps were revealed as the tale progressed; for example, Trumps are not limited to playing cards, but can be drawn on any surface.
|
|
There is a research that described the multi-herbal medicine Gongjin-dan enhances memory and learning tasks via NGF regulation. Abstract The effects of Gongjin-Dan(GDJ) on NGF mimetic activity in PC12 cells and the induction of NGF secretion in primary astrocytes. Moreover, we also measured neuron survival by MAP-2 staining in an immobilization stress rat model and induction of long-term potentiation by the MEA system in rat hippocampus slices treated with dexamethasone. The behavioral syndrome by novel object test was also performed in mice.
|
|
Why it abandoned its African post in 1503 and ended up in India, Correia does not explain. Questions have been raised about the lengthy immobilization of the patrol in Angediva. Given communications along the Indian coast, it would be almost impossible for Ataíde not to be aware that, at that very moment, the Portuguese factory in Cochin was being besieged by the Zamorin of Calicut, and that their compatriots were desperately holding out. It must be assumed that the damage to the patrol ships was too severe to prevent them from sailing to the rescue.
|
|
A short period of immobilization in a below-knee cast or in an Aircast leads to a faster recovery at 3 months compared to a tubular compression bandage. In contrast, a randomized controlled trial has concluded that appropriate exercise immediately after a sprain improves function and recovery. These exercises were focused on increasing ankle range of movement, activation and strengthening of ankle musculature, and restoring normal sensorimotor control, and were carried out for 20 minutes, three times a day. After the injury, it is advisable not to walk for a couple of days.
|
|
Since there may be unwilling or innocent passengers in the car, there is an inherent difficulty in justifying the use of PITs. Some suggest that due to the utilization of electronic control systems on modern vehicles, the policies of using PIT maneuvers might need some more consideration.Zhou et al.Jing Zhou, Jianbo Lu, and Huei Peng, "Vehicle Dynamics In Response to The Maneuver of Precision Immobilization Technique," Proceedings of ASME Dynamic Systems and Control Conference, 2008 provides a study for vehicles equipped with Electronic Stability Controls (ESC) in response to PIT maneuvers.
|
|
"cascade", consists of a group of proteins that interact in the formation of a fibrin-rich clot. Thrombosis is a multifactorial problem because there are often multiple reasons why a person might develop thrombosis. These risk factors may include any combination of abnormalities in the blood vessel wall, abnormalities in the blood flow (as in immobilization), and abnormalities in the consistency of the blood. Thrombophilia is caused by abnormalities in blood consistency, which is determined by the levels of coagulation factors and other circulating blood proteins that participate in the "coagulation cascade".
|
|
These are referred to as toeplates in the orthopedic discipline of medicine. This addition may be applied to further support and stabilize the metatarsals by limiting motion through a higher degree of immobilization, as well as protecting the toes from additional blunt force trauma. Typically leg casts with no toeplate are prescribed for injuries to the foot and metatarsals. Ordinarily, a leg cast applied for the treatment of a stable ankle fracture would not use the toeplate design because there is no need to immobilize and limit the motion of the patient's toes.
|
|
Recently interest in S. ureae has increased due to the potential biotechnological applications; however, research has nearly been exclusively focused on the unique outer cell surface layer (S-layer). S-layers are composed of single proteins that form a predictable lattice structure and have potential applications in nanoelectronics, medicine, and biosensors. An example of this research is the S-layer’s promising role in enzyme immobilization. The process of artificially breaking down certain metabolites and poisons is often slowed by the proximity of the required enzymes needed to one another.
|
|
Chemical Surface Modification of Parylene C for Enhanced Protein Immobilization and Cell Proliferation. Changhong Zhang; Mark E. Thompson; Frank S. Markland; Steve Swenson, Acta Biomaterialia, 2011, 7(10), 3746-56.Improvement of Metal and Tissue Adhesion on Surface-Modified Parylene C. Paulin N. Wahjudi; Jin H. Oh; Salam O. Salman; Jason A. v; Damien C. Rodger; Yu-Chong Tai; Mark E. Thompson, Journal of Biomedical Materials Research, Part A, 2009, 89A(1), 206-214. These adhesives can be used to anchor devices to retina or seal wounds in the sclera.
|
|
28 to 58% of the dorsal ganglia resolve spontaneously, still some patients choose to undergo cosmetic intervention for resection of the ganglion when non-operative treatment failed. Some examples of this non- operative treatment are immobilization through a splint or aspiration of the ganglion with or without injection of a steroid. In some cases the ganglia are associated with serious loss of wrist function or weakness in the affected finger, which makes a surgical intervention highly indicated. Resection of dorsal ganglion are still widely treated with open surgery.
|
|
Surface modification has gained a lot of interest in recent years for a variety of applications. An example of the application of free radical polymerizations to forming new architectures is through RAFT polymerizations which result in dithioester end groups. These dithioesters can be reduced to the thiol which can be immobilized on a metal surface; this is important for applications in electronics, sensing and catalysis. The schematic below demonstrates the immobilization of copolymers onto a gold surface as reported for poly(sodium 4-styrenesulfonate) by the McCormick group at the University of Southern Mississippi.
|
|
Ecosystems dominated by plants with low-lignin concentration often have rapid rates of decomposition and nutrient cycling (Chapin et al. 1982). Simple carbon (C) containing compounds are preferentially metabolized by decomposer microorganisms which results in rapid initial rates of decomposition, see Figure 5A,Aber, J.D., and J.M., Melillo (1982). "Nitrogen immobilization in decaying hardwood leaf litter as a function of initial nitrogen and lignin content". In: Canadian Journal of Botany 60:2263-2269. models that depend on constant rates of decay; so called “k” values, see Figure 5B.
|
|
In: Oecologia 126:104-113 showed that C rich honeydew produced during aphid outbreak can result in increased N immobilization by soil microbes thus slowing down nutrient cycling and potentially limiting biomass production. North atlantic marine ecosystems have been greatly altered by overfishing of cod. Cod stocks crashed in the 1990s which resulted in increases in their prey such as shrimp and snow crab Human intervention in ecosystems has resulted in dramatic changes to ecosystem structure and function. These changes are occurring rapidly and have unknown consequences for economic security and human well-being.
|
|
Other ecosystem services that are diminished or lost altogether as a result of habitat destruction include watershed management, nitrogen fixation, oxygen production, pollination (see pollinator decline), waste treatment (i.e., the breaking down and immobilization of toxic pollutants), and nutrient recycling of sewage or agricultural runoff. The loss of trees from the tropical rainforests alone represents a substantial diminishing of the earth's ability to produce oxygen and use up carbon dioxide. These services are becoming even more important as increasing carbon dioxide levels is one of the main contributors to global climate change.
|
|
Pain is also significant, and can also result in immobilization, so patients are encouraged to become mobile as soon as possible, often with the assistance of physical therapy. Skeletal traction pending surgery is not supported by the evidence. Regional nerve blocks are useful for pain management in hip fractures. Surgery can be performed under general anaesthesia or with neuraxial techniques - choice is based on surgical and patient factors, as outcomes such as mortality and post-procedure complications including pneumonia, MI, stroke or confusion, are not affected by anaesthetic technique.
|
|
Surgical treatment of a Jefferson fracture involves fusion or fixation of the first three cervical vertebrae; fusion may occur immediately, or later during treatment in cases where non-surgical interventions are unsuccessful. A primary factor in deciding between surgical and non-surgical intervention is the degree of stability as well as the presence of damage to other cervical vertebrae. Though a serious injury, the long-term consequences of a Jefferson's fracture are uncertain and may not impact longevity or abilities, even if untreated. Conservative treatment with an immobilization device can produce excellent long-term recovery.
|
|
The general steps common to many of these next-generation sequencing techniques include: # Random fragmentation of genomic DNA # Immobilization of single DNA fragments on a solid support like a bead or a planar solid surface # Amplification of DNA fragments on the solid surface using PCR and making polymerase coloniesChetverin, NAR, 1993, Vol.21, No. 10 2349-2353 # Sequencing and subsequent in situ interrogation after each cycle using fluorescence scanning or chemiluminescence.MATTHEW E. HUDSON (2008) Sequencing breakthroughs for genomic ecology and evolutionary biology. Molecular Ecology Resources 8 (1) , 3–17 In 1988, Whiteley et al.
|
|
The runaway success of DNA microarrays has generated much enthusiasm for protein microarrays. However, protein microarrays have not quite taken off as expected, even with the necessary tools and know-how from DNA microarrays being in place and ready for adaptation. One major reason is that protein microarrays are much more laborious and technically challenging to construct than DNA microarrays. The traditional methods of producing protein arrays require the separate in vivo expression of hundreds or thousands of proteins, followed by separate purification and immobilization of the proteins on a solid surface.
|
|
Ioannis Tsoukalas of Stockholm University has hypothesized that REM sleep is an evolutionary transformation of a well-known defensive mechanism, the tonic immobility reflex. This reflex, also known as animal hypnosis or death feigning, functions as the last line of defense against an attacking predator and consists of the total immobilization of the animal so that it appears dead. Tsoukalas argues that the neurophysiology and phenomenology of this reaction shows striking similarities to REM sleep; for example, both reactions exhibit brainstem control, paralysis, hypocampal theta rhythm, and thermoregulatory changes.Vitelli, R. (2013).
|
|
Whether nitrogen is mineralized or immobilized depends on the C/N ratio of the plant residues.R.G. McLaren & K. Cameron Soil Science: Sustainable production and environmental protection (2nd edition), Oxford University Press, (1996) For example, incorporating materials high in carbon to nitrogen ratio such as saw dust and straw will stimulate soil microbial activity,increase demand for nitrogen, leading to immobilization. This is known as priming effect. In general plant residues entering the soil have too little nitrogen for the soil microbial population to convert all of the carbon into their cells.
|
|
There are two mechanisms of nitrogen immobilization: Nitrogen accumulation in microbial biomass and accumulation of nitrogen in by- products of microbial activity. Nitrogen Accumulation in by-products of microbial activity nitrogen accumulation in decaying plant debris follows a two-phase mechanism Following the initial leaching of soluble materials from fresh detritus, exoenzymes depolymerize the detritus substrate producing reactive carbohydrates, phenolics, small peptides, and amino acids, this is a period whereby microbial growth is rapid. with microbes converting substrate nitrogen and exogenous nitrogen into microbial biomass and exuded products of microbial activity.
|
|
4384-4388 His work on intercellular adhesion led him to establish new techniques for measuring the forces required to detach interacting cells. He demonstrated the crucial role of the cortical actin cytoskeleton in the reinforcement and mechanosensitivity of intercellular adhesion.Thiery J.P., Engl W., Viasnoff V. and Dufour S., « Biochemical and biophysical origins of cadherin selectivity and adhesion strength », Current Op. Cell Biol., (2012), 24, p. 614-619Engl W., Arasi B., Thiery J.P. and Viasnoff V., « Actin dynamics modulate mechanosensitive immobilization of E-cadherin at adherens junctions », Nature Cell Biol.
|
|
A ribosome is a biological machine that utilizes protein dynamics on nanoscales to synthesize proteins Synthetic biology is a field that aims to engineer cells with "novel biological functions." Such cells are usually used to create larger systems (e.g., biofilms) which can be "programmed" utilizing synthetic gene networks such as genetic toggle switches, to change their color, shape, etc. Such bioinspired approaches to materials production has been demonstrated, using self-assembling bacterial biofilm materials that can be programmed for specific functions, such as substrate adhesion, nanoparticle templating, and protein immobilization.
|
|
Surface Plasmon Resonance (SPR) configuration Surface Plasmon Resonance (SPR) does not require labeling of the ligand. Instead, it works by measuring the change in the angle at which the polarized light is reflected from a surface (refractive index). The angle is related to the change in mass or layer of thickness, such as immobilization of a ligand changing the resonance angle, which increases the reflected light. The device for which SPR is derived includes a sensor chip, a flow cell, a light source, a prism, and a fixed angle position detector.
|
|
Her thesis was focused on hybrid materials bearing amylose using enzymatic polymerizations. During her PhD research she worked in 1997 as an international exchange researcher at the Universidade Federal do Rio Grande do Sul, Porto Alegre, Brazil. In 2001, she received a Feodor Lynen research fellowship of the Alexander von Humboldt Foundation to conduct postdoctoral research at the Polytechnic University in Brooklyn, NY, USA, where she worked on fundamentals of self-assembled monolayers and immobilization supports for biocatalysts. In 2003, she started an independent research group at the University of Groningen, the Netherlands.
|
|
The type of silane used can further compound the problem, as in the case of APTES. APTES is the classical molecule used for the immobilization of biomolecules and has historically been the most widely studied molecule in the field by far. Since APTES contains three ethoxy groups per molecule, it can polymerize in the presence of water, leading to lateral polymerization between APTES molecules in horizontal and vertical directions and the formation of oligomers and polymers which can attach to the surface. Self-assembly can be approached using solution-phase reactions or vapor-phase reactions.
|
|
However, researchers in Brazil hypothesized that planting and incorporating Crotalaria juncea with animal manure could enhance the nutrient mineralization pattern for agricultural crops. Field and greenhouse experiments were used to test this hypothesis. After measuring the amounts of Nitrogen, Phosphorus, and Potassium in the soils, it was discovered that Crotalaria juncea along with only half the usual dose of goat manure produced the best results. This is because soils that consisted of this composition avoided immobilization of nitrogen while increasing the levels of phosphorus and potassium within the soil.
|
|
The abundance of cnidocytes in nematosomes led to the early hypothesis that this tissue plays a role in immobilization of prey. Although the veracity of this hypothesis was challenged, recent evidence has confirmed that cniodcytes in nematosomes are capable of firing and immobilizing juvenile brine shrimp. Because nematosomes are embedded in the spawned egg mass, it is likely they also play a role in deterring potential egg predators. This hypothesis has not been tested but anecdotal observations suggest killifish may indeed be deterred by the nematosomes surrounding eggs.
|
|
Despite of using surface plasmon resonance imaging (SPRi) in biology to characterize interactions between two biological molecules, it is also useful to monitor the interactions between two polymers. In this approach, one polymer, called as host protein HP, is immobilized on the surface of a biochip and the other polymer designated as guest polymer GP is inserted on the SPRi-Biochip to study the interactions. For example, a host protein of amine-functionalized poly(β-cyclodextrin) and guest protein of PEG (ada)4. SPRi biochip was used for immobilization of HP of different concentrations.
|
|
Developed in 1932 by Muneomi Sawayama, the art places an equal emphasis on striking techniques using hands and feet, immobilization and controls, projections and take-downs. Nippon Kempo is a defensive art that does not restrict students in methodology. From a technical point of view, Nippon Kempo is a martial art system based on techniques of striking and kicking, (atemi-waza), blocking (uke-waza), throwing (nage-waza), reverse joint locks (kansetsu-gyakutori-waza) and ground combat (ne-waza). It uses techniques derived from other arts including judo, jujutsu, karate, boxing, savate and wrestling.
|
|
If in late stages the lesion is unstable and the cartilage is damaged, surgical intervention is an option as the ability for articular cartilage to heal is limited. When possible, non-operative forms of management such as protected reduced or non-weight bearing and immobilization are used. Surgical treatment includes arthroscopic drilling of intact lesions, securing of cartilage flap lesions with pins or screws, drilling and replacement of cartilage plugs, stem cell transplantation, and in very difficult situation in adults joint replacement. After surgery rehabilitation is usually a two-stage process of unloading and physical therapy.
|
|
During the first 5 days following the surgery, a passive continuous motion machine is used to prevent a prolonged period of immobilization which leads to muscular atrophy and delays functional recovery. During the 4–6 weeks post-surgical, active and passive non-weight bearing motions which flex the knee up to 90° are recommended. For patients with meniscal transplantation, further knee flexion can damage the allograft because of the increased shear forces and stresses. If any weight-bearing exercises are applied, a controlled brace should be worn on the knee to keep the knee at near (<10°) or full extension.
|
|
In the hybridization-ligation assay a template probe replaces the capture probe in the sandwich assay for immobilization to the solid support. The template probe is fully complementary to the oligonucleotide analyte and is intended to serve as a substrate for T4 DNA ligase-mediated ligation. The template probe has in addition an additional stretch complementary to a ligation probe so that the ligation probe will ligate onto the 3'-end of the analyte. Albeit generic, the ligation probe is similar to a detection probe in that it is labelled with, for example, digoxigenin for downstream signalling.
|
|
Mebendazole works by selectively inhibiting the synthesis of microtubules via binding to colchicine binding site of β-tubulin, thereby blocking polymerisation of tubulin dimers in intestinal cells of parasites. Disruption of cytoplasmic microtubules leads to blocking the uptake of glucose and other nutrients, resulting in the gradual immobilization and eventual death of the helminths. Poor absorption in digestive tract makes mebendazole an efficient drug for treating intestinal parasitic infections with limited adverse effects. However mebendazole has impact on mammalian cells mostly by inhibiting polymeration of tubulin dimers, thereby disrupting essential microtubule structures such as mitotic spindle.
|
|
This discovery led to the development of a new family of immobilized enzymes: cross-linked enzyme aggregates (CLEAs). Since precipitation from an aqueous medium, by addition of ammonium sulfate or polyethylene glycol, is often used to purify enzymes, the CLEA methodology essentially combines purification and immobilization into a single unit operation that does not require a highly pure enzyme. It could be used, for example, for the direct isolation of an enzyme, in a purified and immobilized form suitable for performing biotransformations, from a crude fermentation broth. CLEAs are very attractive biocatalysts, owing to their facile, inexpensive and effective production method.
|
|
Side view of breast bondage at BoundCon, Germany, 2008 Breast bondage is a bondage technique which involves the tying of rope around a woman's breasts in a visually intricate and decorative pattern. Breast bondage most commonly uses rope, but webbing, straps or a harness may also be used. Breast bondage often focuses on the decorative, aesthetic and erotic aspects of the result, and not on immobilization of the female subject. However, breast bondage can be combined with other techniques which restrict the subject's mobility and can provide securing points for other bondage plays, such as crotch rope and breast torture.
|
|
Bone growth occurring during flare- ups may result in the loss of mobility to affected joints, including, if the jaw/mandible is involved, the inability to fully open the mouth, limiting speech and eating. A specific occurrence of a flare-up of this condition in the foot/ankle joints can result in the limited ability to put a foot flat on the ground. Bone growth can also result in the immobilization of the hip or knee, affecting the individual's ability to walk. Extra bone formation around the rib cage restricts the expansion of lungs and diaphragm causing respiratory complications.
|
|
For stage I, normally, nonsurgical treatment is sufficient. This type of therapy includes the use of splint or cast immobilization, injections of corticosteroid in the pain causing joints and the use of a systemic non- steroidal anti-inflammatory drug to reduce pain and improve the functional use of the affected joint. However, the amount of pain that can be suppressed by nonsurgical therapy is limited and with the progression of the wrist osteoarthritis surgical treatment is inevitable. In stage I surgical treatment often consists of neurectomy of the posterior interosseous nerve and is often combined with other procedures.
|
|
With custom applications, improper installation may cause the air bags to rub against the vehicle's frame or other surrounding parts, damaging it. The over-extension of an air spring which is not sufficiently constrained by other suspension components, such as a shock absorber, may also lead to the premature failure of an air spring through the tearing of the flexible layers. Failure of an air spring may also result in complete immobilization of the vehicle, since the vehicle will rub against the ground or be too high to move. However, most modern automotive systems have overcome many of these problems.
|
|
Modification of these residues in turn can allow tryptophan to adopt different spatial orientations that would offer alternative regioselectivities. Naturally occurring tryptophan 7-halogenase isolated from Lechevalieria aerocolonigenes was shown to be able to halogenate naphthalene derivatives, albeit only at activated positions, revealing that certain strains of tryptophan 7-halogenase are fairly wide in substrate scope. Free enzyme is precipitated then treated with a cross-linking agent to synthesize CLEAs Following design of a suitable enzyme, a cross-linked enzyme aggregate is used for larger-scale reaction. The enzyme by itself faces stability issues, but immobilization through CLEA circumvents this problem.
|
|
Arrays of gel elements (pads) are created on the glass surface (micromatrix) which is followed by application and chemical immobilization of different compounds (probes) onto these gel pads. Test sample is then added to this micromatrix containing immobilized probes in gel pads and molecular recognition reactions are allowed to take place under specified conditions. The test sample is fluorescent labelled to monitor the molecular interactions. The analysis of molecular interaction patterns is done by using specialized software. Figure 2: Photopolymerization Chamber Figure 3: Schematic of MAGIChip Technology The array of gel elements on a glass slide is prepared by ‘’’photopolymerization‘’’.
|
|
Soil fertility is a complex process that involves the constant cycling of nutrients between organic and inorganic forms. As plant material and animal wastes are decomposed by micro-organisms, they release inorganic nutrients to the soil solution, a process referred to as mineralization. Those nutrients may then undergo further transformations which may be aided or enabled by soil micro- organisms. Like plants, many micro-organisms require or preferentially use inorganic forms of nitrogen, phosphorus or potassium and will compete with plants for these nutrients, tying up the nutrients in microbial biomass, a process often called immobilization.
|
|
The use of plaster of Paris to cover walls is evident, but it seems it was never used for bandages. Ancient Hindus treated fractures with bamboo splints, and the writings of Hippocrates discuss management of fractures in some detail, recommending wooden splints plus exercise to prevent muscle atrophy during the immobilization. The ancient Greeks also used waxes and resins to create stiffened bandages and the Roman Celsus, writing in AD 30, describes how to use splints and bandages stiffened with starch. Arabian doctors used lime derived from sea shells and albumen from egg whites to stiffen bandages.
|
|
A conceptualization of the process of podzolization in a typical Podzol. The soil-forming process of podzolization can be broken down into two main steps: # Mobilization and translocation of organic matter, Fe and Al from the surface horizon, and # Immobilization and stabilization of organic matter, Fe and Al into the subsoil. In the topsoil of acidic soils, organic matter (mostly from plant litter, the humus layer and root exudates) together with Al- and Fe-ions, form organo-mineral complexes. These soluble chelates then relocate with percolating water from the A (or E horizon) to the B-horizon.
|
|
This has the potential to be used in large- scale biosensor arrays or chips for inexpensive multiplexed detection. Thompson has also worked with thermally responsive bioadhesives, designed to bind strongly to ocular tissues, such as retina or sclera, at physiological temperature and release completely at 10 °C.Surface Chemical Immobilization of Parylene C with Thermosensitive Block Copolymer Brushes Based on N-isopropylacrylamide and N-tert-butylacrylamide: Synthesis, Characterization, and Cell Adhesion/Detachment. Mark E. Thompson; Changhong Zhang; Thomas P. Vermier; Yu-Hsuan Wu; Wangrong Yang, Journal of Biomedical Materials Research, Part B: Applied Biomaterials, 2012, 100B(1), 217-229.
|
|
Jervis is a low-level demon portrayed by Jesse Reid appearing in season 11 and season 12 who is loyal to Crowley and then Lucifer. In "Out of the Darkness, Into the Fire," Jervis appears at Marnie's house along with another demon when Crowley summons them using a Goblet of Blood. The demons reassure Crowley that a team is securing his usual vessel and getting a witch to remove Rowena's immobilization spell. After Crowley returns to his usual vessel, Jervis reveals that there was a disturbance in Lucifer's Cage which seemed like either or possibly both Michael and Lucifer screaming.
|
|
This condition is characterized by the formation of an extra skeleton that produces immobilization and eventually death by suffocation. The mutation in ACVR1 causes activin A, which normally acts as an antagonist of the receptor and blocks osteogenesis (bone growth), to behave as an agonist of the receptor and to induce hyperactive bone growth. On 2 September 2015, Regeneron Pharmaceuticals announced that they had developed an antibody for activin A that effectively cures the disease in an animal model of the condition. Mutations in the ACVR1 gene have also been linked to cancer, especially diffuse intrinsic pontine glioma(DIPG).
|
|
Anton van Leeuwenhoek, the famous 17th century microscopist, discovered living organisms (living, because they were mobile) in deposits on the teeth (what we now call dental plaque). He also found organisms in water from the canal next to his home in Delft. He experimented with samples by adding vinegar or brandy and found that this resulted in the immediate immobilization or killing of the organisms suspended in water. Next he tried rinsing the mouth of himself and somebody else with a mouthwash containing vinegar or brandy and found that living organisms remained in the dental plaque.
|
|
2015 Yaël Hassan is a French-Israeli writer born in Paris in 1952. She spent her childhood in Belgium, her adolescence in France, and her youth in Israel. She returned to France in 1984 with her family. Making the most of the time of a very long immobilization, she writes her first novel, A Grandfather Fallen from the Sky (in French Un grand-père tombé du ciel), which won the Youth Novel Prize (Prix du Roman Jeunesse) in 1996 from the Ministry of Youth and Sports, the Young Readers Grand Prize from PEEP in 1998 and the Sorceress Prize in 1998.
|
|
The Murphy button can be credited as the forerunner of the modern end-to-end stapling instrument after having become the method of choice for operations at the Mayo Clinic and elsewhere in the United States for over twenty years. In 1896, Murphy was the first person to successfully unite a femoral artery severed by a gunshot wound. In 1898, Murphy was first in the United States to induce artificial immobilization and collapse of the lung (pneumothorax) in treatment of pulmonary tuberculosis. He pioneered bone grafting techniques and made inroads in the management of ankylosis, especially with reconstruction.
|
|
This response caused a contentious relationship among Kenny, Cilento, the BMA and the Australian Medical Association (AMA). Between 1936 and 1938, a Queensland Government Royal Commission evaluated Kenny's work and published its Report of The Queensland Royal Commission on Modern Methods for the Treatment of Infantile Paralysis in 1938. Its most critical comment, because Kenny opposed using splints and plaster casts was: "The abandonment of immobilization is a grievous error and fraught with grave danger, especially in very young patients who cannot co-operate in re-education." They stated that her clinic (then in Brisbane) was "admirable".
|
|
The Savannah River Site was selected as the location of three new plutonium facilities for: a MOX fuel fabrication; pit disassembly and conversion; and plutonium immobilization. WSRC earned the DOE's top safety performance honor of Star Status. Thousands of shipments of transuranic waste were contained and sent by truck and by rail to the DOE's Waste Isolation Pilot Plant (WIPP) Project in New Mexico, with the first shipments beginning in 2001. DWPF completed production of four million pounds of environmentally acceptable classified waste. In 2002, the F Canyon and FB Line facilities completed their last production run.
|
|
The dressing delivers absorption or hydration as needed over each independent wound area and aids in the natural process of autolytic debridement. It effectively removes liquefied slough and necrotic tissue, disintegrated bacterial biofilm as well as harmful exudate components, known to slow the healing process. The treatment also reduces bacterial load by effective evacuation and immobilization of microorganisms from the wound bed, and subsequent chemical binding of available water that is necessary for their replication. Self-adaptive dressings protect periwound skin from extrinsic factors and infection while regulating moisture balance over vulnerable skin around the wound.
|
|
The bacterial enzyme can be fused to various proteins of interest. The synthetic ligand is chosen from a number of available ligands in accordance with the type of experiments to be performed. This bacterial enzyme is a haloalkane dehalogenase, which acts as a hydrolase and is designed to facilitate visualization of the subcellular localization of a protein of interest, immobilization of a protein of interest, or capture of the binding partners of a protein of interest within its biochemical environment. The HaloTag is composed of two covalently bound segments including a haloalkane dehalogenase and a synthetic ligand of choice.
|
|
Animal venoms are complex biomolecules and hence, their biological synthesis require high metabolic activity. A particular venom itself is a complex chemical mixture composed of hundreds of proteins and non-proteinaceous compounds, resulting in a potent weapon for prey immobilization and predator deterrence. The metabolic cost of venom is sufficiently high to result in secondary loss of venom whenever its use becomes non-essential to survival of the animal. This suggests that venomous animals may have evolved strategies for minimizing venom expenditure, that they should use them only as and when required, and that too in optimal amount.
|
|
B. Zhang, R. Wepf, K. Fischer, M. Schmidt, S. Besse, P. Lindner, B. T. King, R. Siegel, P. Schurtenberger, Y. Talmon, Y. Ding, M. Kröger, A. Halperin, A. D. Schlüter, Angew. Chem. Int. Ed. 2011, 50, 737. Dendronized polymers have been investigated for/as bulk structure control, responsivity to external stimuli, single molecule chemistry, templates for nanoparticle formation, catalysis, electro-optical devices, and bio-related applications. Particularly attractive is the use of water-soluble dendronized polymers for the immobilization of enzymes on solid surfaces (inside glass tubes or microfluidic devices) and for the preparation of dendronized polymer-enzyme conjugates.
|
|
Generalized dystonia has also been treated with such muscle relaxants as the benzodiazepines. Another muscle relaxant, baclofen, can help reduce spasticity seen in cerebral palsy such as dystonia in the leg and trunk. Treatment of secondary dystonia by administering levodopa in dopamine-responsive dystonia, copper chelation in Wilson's disease, or stopping the administration of drugs that may induce dystonia have been proven effective in a small number of cases. Physical therapy has been used to improve posture and prevent contractures via braces and casting, although in some cases, immobilization of limbs can induce dystonia, which is by definition known as peripherally induced dystonia.
|
|
Holly Marie Combs Piper Halliwell (played by Holly Marie Combs) is the second eldest sister who initially receives the power of molecular immobilization, which allows her to "freeze" her surrounding environment. As the series progresses, she also gains the power of molecular combustion, which enables her to combust any object she wishes; this power quickly becomes useful to easily vanquish lower level demons. Piper starts off as the middle sister, but later becomes the eldest after Prue dies. Piper is initially shy and submissive, but gradually develops a much more assertive personality, especially after Prue's death.
|
|
Recent research suggests that there is significant overlap among the three broad categories of symptoms. In addition, sedation and prolonged immobilization seem to be common themes among patients who suffer from PICS. The term PICS arose around 2010, at least in part, to raise awareness of the important long-term dysfunctions resulting from treatment in the intensive care unit (ICU). Awareness of these long-term functional disabilities is growing, and research is ongoing to further clarify the spectrum of disabilities and to find more effective ways to prevent these long-term complications and to more effectively treat functional recovery.
|
|
Phytostabilization is an specially valid strategy for radioactive contamination based on the immobilization of radionuclides in the soil by the action of the roots. This can occur by adsorption, absorption and precipitation within root zone, and ensures that radioactive waste can not be dispersed because soil erosion or leaching. It is useful in controlling tailings from strip and open pit uranium mines, and guarantees to retrieve the ecosystem. However, it has significant drawbacks such as large doses of fertilizer needed to reforest the area, apart from radioactive source (which implies long-term maintenance) remaining at the same place.
|
|
VANTAs act as forests of molecular wires to allow electrical communication between the underlying electrode and a biological entity. The main advantages of VANTAs are the nanosize of the CNT- sensing element and the corresponding small amount of material required for a detectable response. The well-aligned CNT arrays have been employed to work as ribonucleic acid (RNA) sensors, enzymes sensors, DNA sensors, and even protein sensors. Similar VANTAs of MWNTs, grown on platinum substrates, are useful for amperometric electrodes where the oxygenated or functionalized open-ends of nanotubes are used for the immobilization of biological species, while the platinum substrate provides the signal transduction.
|
|
Cell microencapsulation technology involves immobilization of the cells within a polymeric semi-permeable membrane that permits the bidirectional diffusion of molecules such as the influx of oxygen, nutrients, growth factors etc. essential for cell metabolism and the outward diffusion of waste products and therapeutic proteins. At the same time, the semi-permeable nature of the membrane prevents immune cells and antibodies from destroying the encapsulated cells regarding them as foreign invaders. The main motive of cell encapsulation technology is to overcome the existing problem of graft rejection in tissue engineering applications and thus reduce the need for long-term use of immunosuppressive drugs after an organ transplant to control side effects.
|
|
Several ground-based paradigms have been used to emulate the effects of microgravity unloading on human skeletal muscle, including complete horizontal or 6° head-down-tilt bed rest, dry immersion, and unilateral upper- and lower-limb unloading with or without joint immobilization. In general, skeletal muscle responses to unloading have been similar in all of these models. Although no perfect simulation of crew activities and the microgravity environment can be adequately achieved, Adams and colleagues have suggested that bed rest is an appropriate model of spaceflight for studying skeletal muscle physiologic adaptations and countermeasures. Bed rest unloading causes a significant loss of body nitrogen and lean body mass.
|
|
Standard equipment on each ambulance includes some of the following: a Life Pak LP 15/ Zoll M Series cardiac monitor; epinephrine auto-injectors (Epi-Pen); oxygen administered via nasal cannulas; non rebreathing masks and bag valve masks; various length splints; stairchair; oral glucose; sterile gauze bandages and medical tape; blood pressure cuffs; oral suction device. Various immobilization equipment such as backboards, topdecks, KED's are on board each ambulance as well. As well ALS providers carry various medications such as Zofran, Albuterol, Nitroglycerin, Asprin, Morphine, Epinephrine etc. In addition, 700 has a RAD-57 CO detector, which is invaluable at a medical scene to rule out possible Carbon Monoxide poisoning.
|
|
This assistance may take the form of examining and identifying people, places and things, custodial transfers, and providing assistance with the immobilization of the instruments of criminal activity. With regards to the latter, MLATs between the United States and Caribbean nations do not cover U.S. tax evasion, and are therefore ineffective when applied to Caribbean countries, which usually act as offshore "tax havens". Assistance may be denied by either country (according to agreement details) for political or security reasons, or if the criminal offence in question is not equally punishable in both countries. Some treaties may encourage assistance with legal aid for nationals in other countries.
|
|
The Head of State reported that, as of Monday, 11 May, the immobilization mandatory social will be from 8 at night. This will allow attention in banks and markets is extended, which will reduce concentrations of people. The modification in the schedule will not apply to the Loreto, La Libertad, Lambayeque, Tumbes and Piura, where the restriction will continue to be implemented from 4 in the afternoon. Starting Monday, the 18th of this month, children up to the age of 14 will be allowed - accompanied by an adult - to go out for 30 minutes as exercise up to no more than 500 meters from their homes.
|
|
The repeated cycling of these steps is referred to as 'panning', in reference to the enrichment of a sample of gold by removing undesirable materials. Phage eluted in the final step can be used to infect a suitable bacterial host, from which the phagemids can be collected and the relevant DNA sequence excised and sequenced to identify the relevant, interacting proteins or protein fragments. The use of a helper phage can be eliminated by using 'bacterial packaging cell line' technology. Elution can be done combining low-pH elution buffer with sonification, which, in addition to loosening the peptide-target interaction, also serves to detach the target molecule from the immobilization surface.
|
|
4) Fluorescent emission of captured free receptor. Because the fluorescent secondary molecule is applied after capture of the free receptor from solution (Figure 2) the binding constants measured using a kinetic exclusion assay are for unmodified molecules in solution and thus more accurately reflects endogenous binding interactions than methods requiring modification (typically labeling or immobilization) before measurement. Kinetic exclusion assays have been performed using unpurified molecules, in serum, and have measured binding to cell membrane proteins on intact whole cell which brings the measured binding interactions closer to their endogenous state. Molecules suited for measurement by KinExA are antibodies, recombinant proteins, small molecules, aptamers, lipids, nanobodies, and toxins.
|
|
In orthopedic surgery, venous stasis can be temporarily provoked by a cessation of blood flow as part of the procedure. Inactivity and immobilization contribute to venous stasis, as with orthopedic casts, paralysis, sitting, long-haul travel, bed rest, hospitalization, and in survivors of acute stroke. Conditions that involve compromised blood flow in the veins are May–Thurner syndrome, where a vein of the pelvis is compressed, and venous thoracic outlet syndrome, which includes Paget–Schroetter syndrome, where compression occurs near the base of the neck. Cancer can grow in and around veins, causing venous stasis, and can also stimulate increased levels of tissue factor.
|
|
This project, implemented by UNEP, encourages scuba diving operators to educate their students about the importance of marine conservation and encourage them to dive in an environmentally friendly manner that does not damage coral reefs or associated marine ecosystems. Scientists divide the process by a few parts, and there are various techniques in each part of it. In marking and capturing, the normal techniques include techniques for restraint in pinnipeds, chemical restraint and immobilization in pinnipeds, techniques for capture-release of cetaceans and techniques for restraint and handling. Recently, some novel approaches include remote sensing techniques to model exposure of coastal-marine ecosystems to riverine flood plumes and advanced iconography.
|
|
Phytotransformation results in the chemical modification of environmental substances as a direct result of plant metabolism, often resulting in their inactivation, degradation (phytodegradation), or immobilization (phytostabilization). In the case of organic pollutants, such as pesticides, explosives, solvents, industrial chemicals, and other xenobiotic substances, certain plants, such as Cannas, render these substances non-toxic by their metabolism. In other cases, microorganisms living in association with plant roots may metabolize these substances in soil or water. These complex and recalcitrant compounds cannot be broken down to basic molecules (water, carbon-dioxide, etc.) by plant molecules, and, hence, the term phytotransformation represents a change in chemical structure without complete breakdown of the compound.
|
|
All general anaesthetics induce immobilization (absence of movement in response to noxious stimuli) through depression of spinal cord functions, whereas their amnesic actions are exerted within the brain. According to the Meyer-Overton correlation the anaesthetic potency of the drug is directly proportional to its lipid solubility, however, there are many compounds that do not satisfy this rule. These drugs are strikingly similar to potent general anaesthetics and are predicted to be potent anaesthetics based on their lipid solubility, but they exert only one constituent of the anaesthetic action (amnesia) and do not suppress movement (i.e. do not depress spinal cord functions) as all anaesthetics do.
|
|
This appears to be true in cases of internal bleeding, especially penetrating trauma such as gunshot or stab wounds. Thus, minimal time is spent providing prehospital care (spine immobilization; "ABCs", i.e. ensure airway, breathing and circulation; external bleeding control; endotracheal intubation) and the victim is transported as fast as possible to a trauma centre.Accidental Death and Disability: The Neglected Disease of Modern Society, (1966), National Academy of Sciences (White Paper) The aim in "Scoop and Run" treatment is generally to transport the patient within ten minutes of arrival, hence the birth of the phrase, "the platinum ten minutes" (in addition to the "golden hour"), now commonly used in EMT training programs.
|
|
Inactivity and starvation in mammals lead to atrophy of skeletal muscle, accompanied by a smaller number and size of the muscle cells as well as lower protein content. In humans, prolonged periods of immobilization, as in the cases of bed rest or astronauts flying in space, are known to result in muscle weakening and atrophy. Such consequences are also noted in small hibernating mammals like the golden-mantled ground squirrels and brown bats. Bears are an exception to this rule; species in the family Ursidae are famous for their ability to survive unfavorable environmental conditions of low temperatures and limited nutrition availability during winter by means of hibernation.
|
|
Many potential applications have been suggested in literature, including enzyme immobilization, drug delivery systems, and nanotechnological self- assembly of materials. Though DNA is not the natural choice for building active structures for nanorobotic applications, due to its lack of structural and catalytic versatility, several papers have examined the possibility of molecular walkers on origami and switches for algorithmic computing.DNA 'organises itself' on silicon,BBC News, August 17, 2009 The following paragraphs list some of the reported applications conducted in the laboratories with clinical potential. Researchers at the Harvard University Wyss Institute reported the self-assembling and self-destructing drug delivery vessels using the DNA origami in the lab tests.
|
|
This gives the tendon sheaths a chance to heal, reducing swelling, which then may decrease the pressure on the median nerve. Splints also aim to keep the wrist at a certain angle to decrease pressure within the carpal tunnel. Although there has been debate about the best angle for wrist immobilization, the authors of a systematic review on non surgical carpal tunnel treatments conclude that “there is limited evidence that the use of a wrist splint in neutral position is more effective than an extended wrist position of 20 degrees in patients with CTS in the short term.” In another systematic review on interventions for CTS, Muller et al.
|
|
Snake venom is a highly modified saliva containing zootoxins that facilitate the immobilization and digestion of prey, and defense against threats. It is injected by unique fangs during a bite, and some species are also able to spit their venom. The glands that secrete the zootoxins are a modification of the parotid salivary glands found in other vertebrates, and are usually situated on each side of the head, below and behind the eye, and encapsulated in a muscular sheath. The glands have large alveoli in which the synthesized venom is stored before being conveyed by a duct to the base of channeled or tubular fangs through which it is ejected.
|
|
Nucleic acid sensing using gene-specific nucleic acid amplification with a fluorescence dye or a probe, nucleic acid microarrays, such as DNA microarrays, have become important tools for genetic analysis, gene expression profiling, and genetic-based diagnostics. In the gene-specific nucleic acid amplification, standard PCR or isothermal amplification, such as loop-mediated isothermal amplification (LAMP), is used to amplify the target genetic marker with the DNA-binding fluorescence dye or a sequence-specific probe is applied for signal generation. The fluorescence can be detected in a modified CD/DVD drive or a disc device. In the nucleic acid microarrays, the process of probe immobilization and signal amplification can be separated into five steps.
|
|
During the fierce firefight following the temporary > immobilization of one of the units, Petty Officer Williams was wounded. > Despite his painful injuries, he was able to lead his patrol back through > the heavy enemy fire. His patrol had successfully interdicted a crossing > attempt of three heavy-weapons companies totaling nearly four hundred men, > had accounted for sixteen enemy killed in action, twenty wounded, the > destruction of nine enemy sampans and junks, seven enemy structures, and > 2400 pounds of enemy rice. By his outstanding display of decisive > leadership, his unlimited courage in the face of heavy enemy fire, and his > utmost devotion to duty, Petty Officer Williams upheld the highest > traditions of the United States Naval Service.
|
|
In the production of fine chemicals, flavors and fragrances, agrochemicals and pharmaceuticals an important benefit of enzymes is the high degree of chemoselectivity, regioselectivity and enantioselectivity which they exhibit. Particularly, their ability to catalyze the formation of products in high enantiopurity, by an exquisite stereochemical control, is of the utmost importance in these industries. Notwithstanding all these desirable characteristic features of enzymes their widespread industrial application is often hampered by their lack of long term operational stability and shelf-storage life, and their cumbersome recovery and re-use. These drawbacks can generally be overcome by immobilization of the enzyme and a major challenge in industrial biocatalysis is the development of stable, robust and preferably insoluble biocatalysts.
|
|
Various models for which sufficient data have been collected have been concisely reviewed. Such models include horizontal or head-down bed rest, dry immersion bed rest, limb immobilization, and unilateral lower-limb suspension. While none of these ground-based analogs provides a perfect simulation of human microgravity exposure during spaceflight, each is useful for study of particular aspects of muscle unloading as well as for investigation of sensorimotor alterations. Due to limitations in the number of spaceflights and crewmembers in which novel countermeasures can be tested, future development, evaluation and validation of new countermeasures to the effects of skeletal muscle unloading will likely employ variations of these same basic ground-based models.
|
|
The Milwaukee brace, also known as a cervico-thoraco-lumbo-sacral orthosis or CTLSO, is a back brace most often used in the treatment of spinal curvatures (such as scoliosis or kyphosis) in children but also, more rarely, in adults to prevent collapse of the spine and associated pain and deformity. It is a full-torso brace that extends from the pelvis to the base of the skull. It was originally designed by Blount and Schmidt in 1946 for postoperative care when surgery required long periods of immobilization. Milwaukee braces are often custom-made over a mold of the patient's torso, but in some cases, it can be made from prefabricated parts.
|
|
The main object of the game is to move a rabbit of one's own color onto the home rank of the opponent, which is known as a goal. Thus Gold wins by moving a gold rabbit to the eighth rank, and Silver wins by moving a silver rabbit to the first rank. However, because it is difficult to usher a rabbit to the goal line while the board is full of pieces, an intermediate objective is to capture opposing pieces by pushing or pulling them into the trap squares. The game can also be won by capturing all of the opponent's rabbits (elimination) or by depriving the opponent of legal moves (immobilization).
|
|
Transfer agents provide a variety of services to issuing companies, including: maintaining a registry of all shareholders, paying dividends and conducting proxy campaigns. Most investments in US equities, corporate bonds and municipal bonds are now held in book entry form, rather than certificates as was the case as recently as the early 1970s when Depository Trust & Clearing Corporation (DTCC) began operations. Thus with the general acceptance of stock immobilization at the central depository, most of the registry function has shifted to reconciling daily immobilized positions with DTCC's nominee firm, Cede & Co. For example, a company has issued 10 million shares. 100,000 shares have been issued in certificated form to a variety of investors.
|
|
According to the Web of Science, the most-cited articles of this journal are: # "'Automated docking of flexible ligands: Applications of AutoDock", Volume 9, Issue 1, Jan-Feb 1996, Pages: 1-5, Goodsell DS, Morris GM, Olson AJ. # "Improving biosensor analysis", Volume 12, Issue 5, Sep-Oct 1999, Pages: 279-284, Myszka DG. # "Reversible and irreversible immobilization of enzymes on Graphite Fibrils(TM)", Volume 9, Issue 5-6, Sep-Dec 1996, Pages: 383-388, Dong LW, Fischer AB, Lu M, et al. # "Isothermal titration calorimetry and differential scanning calorimetry as complementary tools to investigate the energetics of biomolecular recognition", Volume 12, Issue 1, Jan-Feb 1999, Pages: 3–18, Jelesarov I, Bosshard HR.
|
|
For insensitivity to pain: Modify as much as reasonable a child's activities to prevent injuries. Inability to provide proper immobilization as a treatment for orthopedic injuries often delays healing; additionally, bracing and invasive orthopedic procedures increase the risk for infection. Methods used to prevent injuries to the lips, buccal mucosa, tongue, and teeth include tooth extraction, and/or filing (smoothing) of the sharp incisal edges of teeth, and/or use of a mouth guard. Skin care with moisturizers can help prevent palmar and plantar hyperkeratosis and cracking and secondary risk of infection; neurotrophic keratitis is best treated with routine care for dry eyes, prevention of corneal infection, and daily observation of the ocular surface.
|
|
The free diffusion model assumes Dpp to diffuse freely through the extracellular matrix, degrading via receptor- mediated degradation events. FRAP assays have argued against this model by noting that diffusion of GFP-Dpp does not match that expected of a similarly sized molecule. However, others have argued that a rate-limiting slow step further downstream of the process such as slow immobilization and/or slow degradation of Dpp itself could account for the observed differences in diffusion. Single molecules of Dpp have been tracked using fluorescence correlation spectroscopy (FCS), showing that 65% of Dpp molecules diffuse rapidly (consistent with the free diffusion model) and 35% diffuse slowly (consistent with Dpp bound to receptors or glypicans).
|
|
In the Mössbauer effect the narrow resonance absorption for nuclear gamma absorption can be successfully attained by physically immobilizing atomic nuclei in a crystal. The immobilization of nuclei at both ends of a gamma resonance interaction is required so that no gamma energy is lost to the kinetic energy of recoiling nuclei at either the emitting or absorbing end of a gamma transition. Such loss of energy causes gamma ray resonance absorption to fail. However, when emitted gamma rays carry essentially all of the energy of the atomic nuclear de-excitation that produces them, this energy is also sufficient to excite the same energy state in a second immobilized nucleus of the same type.
|
|
A thoracolumbosacral orthosis (TLSO), is a two-piece plastic brace supporting the spine from the thoracic vertebrae of the chest, to the base of the spine at the sacrum. The rigid lumbar or TLSO (Thoraco – Lumbo – Sacral – Orthosis) is used, when regardless of surgical correction, or in some cases in place of surgical correction, spinal stability has not been fully achieved. In some cases of spinal fractures these can be managed without surgery using such a TLSO brace but this is only in the case where the type of fracture has its own inherent stability. The brace provides additional immobilization, which should safely allow condition or fracture to heal with a minimal risk of further injury.
|
|
Under these circumstances, this brace must be worn for approximately several months whenever the patient is out of bed. In other cases the doctor or orthotist may prescribe such a brace to deal post-surgery immobilization, or for the longer term treatment of conditions of a more progressive nature, such as correction of scoliosis in the growing adolescent. These are described briefly below: After having undergoing complex spinal surgeries, this is especially the fusion procedures, a brace will probably be necessary. There are a number of factors determining the need for brace wear include: - the severity of any instability, the lack of good bone quality, the location of the surgery, or the nature of the deformity.
|
|
Healing time varies based on age, health, complexity, and location of the break, as well as the bone displacement. For adults, one to several weeks of sling immobilization is normally employed to allow for pain relief, initial bone and soft tissue healing; teenagers require slightly less, while children can often achieve the same level in two weeks. During this period, patients may remove the sling to practice passive pendulum range of motion exercises to reduce atrophy in the elbow and shoulder, but they are often minimized to 15–20° off vertical. Depending on the severity of fracture, a person can begin to use the arm if comfortable with movement and no pain results.
|
|
Leitner's scientific work focuses on the development of catalysts and catalyst technologies for sustainable chemical processes (Green Chemistry). The focus is on the development and understanding of the mode of action of molecular catalysts, including detailed experimental and computer chemical studies of the mechanisms and structural-effect relationships in organometallic catalysis. Particular attention is paid to new material conversions and the use of new raw materials for catalytic synthesis as well as to the use of modern reaction media (supercritical fluids, ionic liquids, polyethylene glycol (PEG) and others) for catalytic processes. Multiphase catalysis and catalyst immobilization as well as the development of reactional concepts for continuous processes in molecular catalysis are also important research interests.
|
|
Plaster is widely used as a support for broken bones; a bandage impregnated with plaster is moistened and then wrapped around the damaged limb, setting into a close-fitting yet easily removed tube, known as an orthopedic cast. Plaster is also used in preparation for radiotherapy when fabricating individualized immobilization shells for patients. Plaster bandages are used to construct an impression of a patient's head and neck, and liquid plaster is used to fill the impression and produce a plaster bust. The transparent material polymethyl methacrylate (Plexiglas, Perspex) is then vacuum formed over this bust to create a clear face mask which will hold the patient's head steady while radiation is being delivered.
|
|
Zinc deficiency is common in many different types of soil; some soils (sandy soils, histosols and soils developed from highly weathered parent material) have low total zinc concentrations, and others have low plant-available zinc due to strong zinc sorption (calcareous soils, highly weathered soils, vertisols, hydromorphic soils, saline soils). Soils low in organic matter (such as where topsoils have been removed), and compacted soils that restrict root proliferation also have a high risk of zinc deficiency. Application of phosphorus fertilizers has frequently been associated with zinc deficiency; this may be due to enhanced sorption by clay minerals (especially iron oxides), suppression of vesicular arbuscular mycorrhizae and/or immobilization of zinc in plant tissues. Liming of soils also frequently induces zinc deficiency by increasing zinc sorption.
|
|
Individual fibers (slow and fast) of the monkey displayed functional properties that were more closely aligned to those of human fibers than to those of rodents, in that the fibers were larger but less powerful per unit cross-sectional area than rodent fibers. However, in pre- versus postflight analyses of single fibers, slow fibers in both the slow-twitch soleus and triceps muscles underwent greater atrophy and reductions in force and power production than fast-twitch fibers. Also, transformations in the myosin heavy chain profile indicated that there was a greater level of hybrid slow/fast fibers in the two different muscle groups. Immobilization of the triceps muscle group produced similar responses, but the magnitude of change was much less than that in the spaceflight animals.
|
|
In rabbits, collagen fascicles that are immobilized have shown decreased tensile strength, and immobilization also results in lower amounts of water, proteoglycans, and collagen crosslinks in the tendons. Several mechanotransduction mechanisms have been proposed as reasons for the response of tenocytes to mechanical force that enable them to alter their gene expression, protein synthesis, and cell phenotype, and eventually cause changes in tendon structure. A major factor is mechanical deformation of the extracellular matrix, which can affect the actin cytoskeleton and therefore affect cell shape, motility, and function. Mechanical forces can be transmitted by focal adhesion sites, integrins, and cell-cell junctions. Changes in the actin cytoskeleton can activate integrins, which mediate “outside-in” and “inside-out” signaling between the cell and the matrix.
|
|
Currently the most wide spread DNA sequencing technology in use is one developed by Illumina which involves immobilization of single stranded DNA on a solid support, polymerase chain reaction (PCR) amplification of the sequences, and labeling of the individual DNA bases with complementary bases tagged with fluorescent markers (see Illumina dye sequencing). The fluorescence pattern (a different color for each of the four DNA bases) can then be captured in an image and processed to determine the DNA sequence. A recently developed alternative is the nanopore technology in which DNA molecules are passed through a nano scale pore under the control of a ratcheting enzyme. The passage of the DNA molecules causes small change in electrical current that can be measured.
|
|
Despite the large size and extreme immobilization some casts, particularly those used in or before the 1970s, the popular term full body cast is something of a misnomer. The popular and media-driven conception of a massive cast encasing all four limbs, the trunk, and the head – sometimes leaving only small slits for the eyes, nose, and mouth – is a true rarity in recorded medical history, and this type of large scale cast appears more commonly in various Hollywood movies and on television shows. The term body cast (or full body cast) is sometimes casually used by laymen to describe any of a number of body and/or spica casts, from a simple body jacket to a more extensive hip spica.
|
|
For twenty years she worked part-time at the Adelaide Children's Hospital, where she encountered many cases of infantile anterior poliomyelitis, an acute infectious viral disease affecting the brain and spinal cord, causing weakness, paralysis, and wasting of muscle, for which the classic treatment was bed rest and immobilization of affected limbs. Finnis however was convinced of the efficacy of treatments espoused by Sister Kenny, of actively re-educating individual muscles. She made a major contribution during the polio epidemic of 1937–1938 and later. She served on several committees of the Crippled Children's Association of South Australia and was president from 1945 to 1957 of the Spastic Children's Parents' Group, later known as the Crippled Children's Auxiliary (Spastic Group).
|
|
The local media coverage on the deployment of "elite" Puerto Rican Police units inside and outside campus, showed images of alleged students and strike activists, allegedly arrested using excessive methods (including pepper spray use and immobilization of jaws to facilitate detention). This provoked general criticism against a police presence inside the Río Piedras campus. The turning point was the mutiny in front of Lazaro Library on February 9, where students fought back against the police for having used excessive force while trying to detain students during an event for the painting of "Conscience Street". The police attack angered the public, who rallied a massive phone campaign to the Governor's mansion, pleading for the Police to be driven off the campus.
|
|
X-ray showing the proximal portion of a fractured tibia with an intramedullary nail mandibular angle fracture; fixation of the bone fragments by the plates, the principles of osteosynthesis are stability (immobility of the fragments that creates the conditions for bones coalescence) and functionality Proximal femur nail with locking and stabilisation screws for treatment of femur fractures of left thigh Treatment of bone fractures are broadly classified as surgical or conservative, the latter basically referring to any non-surgical procedure, such as pain management, immobilization or other non-surgical stabilization. A similar classification is open versus closed treatment, in which open treatment refers to any treatment in which the fracture site is opened surgically, regardless of whether the fracture is an open or closed fracture.
|
|
The scope of medical practice for EMTs is regulated by state law, and can vary significantly both among states as well as inside states. In general, EMTs provide what is considered basic life support and are limited to essentially non-invasive procedures. Besides employing basic medical assessment skills, typical procedures provided by EMTs include CPR, Automated external defibrillation, mechanical ventilation using a bag-valve mask, placement of air way adjuncts such as oropharyngeal and nasopharyngeal airways, pulse oximetry, glucose testing using a glucometer, splinting (including spinal immobilization and traction splints), and suctioning. In addition, EMT-Bs are trained to assist patients with administration of certain prescribed medications, including nitroglycerin, Metered-dose inhaler such as albuterol, and epinephrine auto injectors such as the EpiPen.
|
|
Encapsulation of probiotic bacteria (Lactobacillus casei) in alginate microspheres together with botryosphaeran and mucilages from linseed and okra increases the encapsulation efficiency, and improves the stability of the encapsulated probiotic bacteria during prolonged storage at 5°C. Gastrointestinal simulation of the microencapsulated Lactobacillus casei cells demonstrated preservation of the viability of the probiotic bacteria against low pH and bile salts. The use of botryosphaeran in microencapsulating probiotic bacteria appears to be another promising application for this β-glucan. New applications for botryosphaeran have included: biological response modifying activities of derivatized botryosphaerans; treatment of skin conditions (eczema, psoriasis, wound healing); antimicrobial activities; antinociceptive activity; as a matrix for enzyme (laccase) immobilization; as a platform for electrochemical sensors; and as a food additive (nutraceutical).
|
|
Other types of bacteria, so-called phosphate-solubilizing bacteria, such as Pantoea agglomerans strain P5 or Pseudomonas putida strain P13, are able to solubilize the insoluble phosphate from organic and inorganic phosphate sources. In fact, due to immobilization of phosphate by mineral ions such as Fe, Al and Ca or organic acids, the rate of available phosphate (Pi) in soil is well below plant needs. In addition, chemical Pi fertilizers are also immobilized in the soil, immediately, so that less than 20 percent of added fertilizer is absorbed by plants. Therefore, reduction in Pi resources, on one hand, and environmental pollutions resulting from both production and applications of chemical Pi fertilizer, on the other hand, have already demanded the use of phosphate-solubilizing bacteria or phosphate biofertilizers.
|
|
Host recognition of bacteriophages occur via bacteria-binding proteins that have strong binding affinities to specific protein or carbohydrate structures on the surface of the bacterial host. Bacteria-binding proteins derived from bacteriophage coating paramagnetic beads will bind to specific cell components present on the surface of host thus capturing the cells and facilitate the concentration of these bead-attached cells.Kretzer JW, Lehmann R, Banz M, Kim KP, Korn C. Loessner MJ (2007) Use of high affinity cell wall-binding domains of bacteriophage endolysins for immobilization and separation of bacterial cells. Appl Environ Microbiol 73:1992-2000Rozand C, Feng P.C.H. Specificity analysis of a novel Phage-derived ligand in an Enzyme-Linked Fluorescent Assay for the detection of Escherichia coli O157:H7.
|
|
So the company was under fire for having not completed the inspection on aircraft and the financial status of the company. The immobilization of each DC-8 represented for the company a 50% decrease in its revenues and that since the beginning of 1996 the SAUCA was lowered by the FAA to category two, for not exercising an adequate inspection on the airlines. In mid-1997 the FAA fined Arca with a sum of $68,000, for not complying with a maintenance plan. According to the FAA, Arca made a series of flights on the Douglas DC-8-55F, the N5824A, between June 1992 and August 1993 without a necessary ventilation system for the main cargo door within a stipulated period.
|
|
Dyer told readers to pursue self actualization, calling reliance on the self a guide to "religious" experience, and suggested that readers emulate Jesus Christ, whom he termed both an example of a self- actualized person and a "preacher of self-reliance". Dyer criticized societal focus on guilt, which he saw as an unhealthy immobilization in the present due to actions taken in the past. He encouraged readers to see how parents, institutions, and even they, themselves, had imposed guilt trips upon themselves. Although Dyer initially resisted the spiritual tag, by the 1990s he had altered his message to include more components of spirituality when he wrote the book Real Magic and discussed higher consciousness in the book Your Sacred Self.
|
|
Treatment options include modified activity with or without weight bearing; immobilization; cryotherapy; anti-inflammatory medication; drilling of subchondral bone; microfracture; removal or reattachment of loose bodies; mosaicplasty and osteoarticular transfer system (OATS) procedures. The primary goals of treatment are: # Enhance the healing potential of subchondral bone; # Fix unstable fragments while maintaining joint congruity; and # Replace damaged bone and cartilage with implanted tissues or cells that can grow cartilage. The articular cartilage's capacity for repair is limited: partial-thickness defects in the articular cartilage do not heal spontaneously, and injuries of the articular cartilage which fail to penetrate subchondral bone tend to lead to deterioration of the articular surface. As a result, surgery is often required in even moderate cases where the osteochondral fragment has not detached from the bone (Anderson Stage II, III).
|
|
The differences observed between cast immobilization and unilateral limb suspension or bed rest protocols may reflect the former being a better model of muscle atrophy induced by hypokinesia and the latter two being better models of muscle atrophy induced by muscle hypodynamia. The latter situation more closely resembles the actual conditions experienced by crewmembers during spaceflight, namely removal of mechanical loading without a reduction in limb mobility. However, it is apparent that although ground-based unloading models are useful in studying the effects of microgravity on skeletal muscle, no single terrestrial model system produces all the physiological adaptations in skeletal muscle observed as a consequence of spaceflight. Absent from human analog studies are the unique operational and psychological stressors associated with spaceflight that exacerbate the physiological changes resulting from muscle unloading.
|
|
A positive priming effect results in the acceleration of mineralization while a negative priming effect results in immobilization, leading to N unavailability. Although most changes have been documented in C and N pools, the priming effect can also be found in phosphorus and sulfur, as well as other nutrients. Löhnis was the first to discover the priming effect phenomenon in 1926 through his studies of green manure decomposition and its effects on legume plants in soil. He noticed that when adding fresh organic residues to the soil, it resulted in intensified mineralization by the humus N. It was not until 1953, though, that the term priming effect was given by Bingeman in his paper titled, The effect of the addition of organic materials on the decomposition of an organic soil.
|
|
Speeds must be lower and the "landing site" for the bumped vehicle must be clear of danger. The first US law enforcement agency to teach PIT as a technique to halt fleeing vehicles was the Fairfax County Police Department in Virginia, Eric J. S. Townsend, "Police End Car Chases with a Spin", News and Record, 2004 which modified the parameters for initiating and executing the technique for police use. Terry Pearson and Joseph McDowell were the first law enforcement officers to incorporate the technique into training. Terry Pearson named it the "Precision Immobilization Technique" or P.I.T. A publication of the United States National Institute of Justice wrote in 1996: > Known initially as "tactical ramming" or "legal intervention", this maneuver > was more fully developed and popularized more than a decade ago by BSR Inc.
|
|
Since the hydrogenase-based biofuel cell hosts a redox reaction, hydrogenase must be immobilized on the electrode in such a way that it can exchange electrons directly with the electrode to facilitate the transfer of electrons. This proves to be a challenge in that the active site of hydrogenase is buried in the center of the enzyme where the FeS clusters are used as an electron relay to exchange electrons with its natural redox partner. Possible solutions for greater efficiency of electron delivery include the immobilization of hydrogenase with the most exposed FeS cluster close enough to the electrode or the use of a redox mediator to carry out the electron transfer. Direct electron transfer is also possible through the adsorption of the enzyme on graphite electrodes or covalent attachment to the electrode.
|
|
Biomolecular engineering is the application of engineering principles and practices to the purposeful manipulation of molecules of biological origin. Biomolecular engineers integrate knowledge of biological processes with the core knowledge of chemical engineering in order to focus on molecular level solutions to issues and problems in the life sciences related to the environment, agriculture, energy, industry, food production, biotechnology and medicine. Biomolecular engineers purposefully manipulate carbohydrates, proteins, nucleic acids and lipids within the framework of the relation between their structure (see: nucleic acid structure, carbohydrate chemistry, protein structure,), function (see: protein function) and properties and in relation to applicability to such areas as environmental remediation, crop and livestock production, biofuel cells and biomolecular diagnostics. The thermodynamics and kinetics of molecular recognition in enzymes, antibodies, DNA hybridization, bio-conjugation/bio-immobilization and bioseparations are studied.
|
|
Bao is a pig who is exclusive to Kung Fu Panda: Legends of Awesomeness. Bao first appeared in "Master Ping" where he and his accomplices Lao and Tsao attacked Mr. Ping's noodle shop only to be defeated by Po. When Bao decides that he, Lao, and Tsao want to learn Kung Fu, they decide to abduct Master Shifu and force him to teach them Kung Fu. Unfortunately, they mistook Mr. Ping as Master Shifu as Mr. Ping only knew of the Chao Wa Punch Kick move which causes immobilization on whoever is hit by it. Bao and his followers decide to use it on Po when he comes to rescue Mr. Ping. With help from Po, Mr. Ping manages to use the Chao Wa Punch Kick on Bao and his followers.
|
|
With 58 nuclear reactors contributing about 75% of its electricity, the highest percentage of any country, France has been reprocessing its spent reactor fuel since the introduction of nuclear power there. Some reprocessed plutonium is used to make fuel, but more is being produced than is being recycled as reactor fuel. France also reprocesses spent fuel for other countries, but the nuclear waste is returned to the country of origin. Radioactive waste from reprocessing French spent fuel is expected to be disposed of in a geological repository, pursuant to legislation enacted in 1991 that established a 15-year period for conducting radioactive waste management research. Under this legislation, partition and transmutation of long-lived elements, immobilization and conditioning processes, and long-term near surface storage are being investigated by the Commissariat à l’Energie Atomique (CEA).
|
|
Ongoing research on ettringite and cement phase minerals is in general to find ways to immobilize wastes and heavy metals from soils and the environment; this can be done by use of the proper cement phase forming mineral by use of lattice to extract according elements. For example, it is reported that copper immobilization at high pH can be achieved through formation of CSH/CAH and ettringite.Moon DH, Park JW, Cheong KH, Hyun S, Koutsospyros A, Park JH, Ok YS. (2013): Stabilization of lead and copper contaminated firing range soil using calcined oyster shells and fly ash, Environ Geochem Health 35 It is suggested that the crystal morphology of ettringite Ca6Al2(SO4)3(OH)12·26H2O can incorporate a variety of divalent ions: Cu2+, Pb2+, Cd2+ and Zn2+, which can substitute for the Ca2+ by incorporating these ions into the lattice.
|
|
In animal models, extensive studies have been conducted to investigate the effects of mechanical strain in the form of activity level on tendon injury and healing. While stretching can disrupt healing during the initial inflammatory phase, it has been shown that controlled movement of the tendons after about one week following an acute injury can help to promote the synthesis of collagen by the tenocytes, leading to increased tensile strength and diameter of the healed tendons and fewer adhesions than tendons that are immobilized. In chronic tendon injuries, mechanical loading has also been shown to stimulate fibroblast proliferation and collagen synthesis along with collagen realignment, all of which promote repair and remodeling. To further support the theory that movement and activity assist in tendon healing, it has been shown that immobilization of the tendons after injury often has a negative effect on healing.
|
|
Apart from the abovementioned forms of thrombophilia, the risk of recurrence after an episode of thrombosis is determined by factors such as the extent and severity of the original thrombosis, whether it was provoked (such as by immobilization or pregnancy), the number of previous thrombotic events, male sex, the presence of an inferior vena cava filter, the presence of cancer, symptoms of post-thrombotic syndrome, and obesity. These factors tend to be more important in the decision than the presence or absence of a detectable thrombophilia. Those with antiphospholipid syndrome may be offered long-term anticoagulation after a first unprovoked episode of thrombosis. The risk is determined by the subtype of antibody detected, by the antibody titer (amount of antibodies), whether multiple antibodies are detected, and whether it is detected repeatedly or only on a single occasion.
|
|
Covalent bonding of the catalyst to a polymer or other solid support is perhaps most common, although immobilization of the catalyst may also be achieved by adsorption onto a surface, ion exchange, or even physical encapsulation. One drawback of this approach is the potential for the proximity of the support to change the behaviour of the catalyst, lowering the enantioselectivity of the reaction. To avoid this, the catalyst is often bound to the support by a long linker though cases are known where the proximity of the support can actually enhance the performance of the catalyst. The final approach involves the construction of MOFs that incorporate chiral reaction sites from a number of different components, potentially including chiral and achiral organic ligands, structural metal ions, catalytically active metal ions, and/or preassembled catalytically active organometallic cores.
|
|
Treatment of scaphoid fractures is guided by the location in the bone of the fracture (proximal, waist, distal), displacement (or instability) of the fracture, and patient tolerance for cast immobilization. Non displaced or minimally displaced waist and distal fractures have a high rate of union with closed cast management. The choice of short arm, short arm thumb spica or long arm cast is debated in the medical literature and no clear consensus or proof of the benefit of one type of casting or another has been shown; although it is generally accepted to use a short arm or short arm thumb spica for non displaced fractures. Non displaced or minimally displaced fracture can also be treated with percutaneous or minimal incision surgery which if performed correctly has a high union rate, low morbidity and faster return to activity than closed cast management.
|
|
The claim was settled in 2006 for $0.30. In 2001, Bechtel began work on the Hanford Tank Waste Treatment and Immobilization Plant at the Hanford site in Washington state. The project is a highly complex plant for the treatment of radioactive liquid waste that has employed new technologies and construction techniques that are the first of their kind. As of 2013, it is considered the most complex project in the US. Management of the project has been the subject of controversy including the Department of Energy's Inspector General reports and Government Accountability Office studies regarding rising costs, nuclear safety and quality, and whistleblower allegations. For example, in 2013 the DOE Inspector General concluded that "Bechtel determined that there was a systemic problem and a breakdown in controls over the review of design changes", but that the company had taken steps to correct the problems.
|
|
The use of pressure immobilization bandages in the first aid management of cubozoan envenomings Toxicon 2002 The application of vinegar is recommended treatment because vinegar (4–6% acetic acid) permanently deactivates undischarged nematocysts, preventing them from opening and releasing venom. A 2014 study demonstrated in vitro that while vinegar deactivates unfired nematocysts, there was also an increase in venom concentration in the solution, possibly by causing already- fired nematocysts (which still contain some venom) to release what remained. However, this study has been criticized on several methodological grounds, including that the experiment was done using a model membrane that is much different from (and more simple than) human skin. Also, the researchers did not determine whether the increase in venom concentration was caused by already-discharged nematocysts releasing more venom, or if the venom that was released initially had simply leaked back out through the membrane, thus confounding the concentration measurement.
|
|
Some authors, for example Randolph Nesse, warn us that patterns of behavior commonly considered inappropriate or even pathological may well have adaptive value. Evolutionary psychology provides several possible explanations for why humans typically respond to social dynamics in the way that they do, including possible functions of self-esteem in relation to dominance hierarchies. In a synhronic perspective behaviors considered abnormal may in fact be part of an adaptive response to stressors in modern or at least in old environments, for example social stressors from chronic subordination or interpersonal conflicts (Gilbert et alli, 2002; Allen & Badcock, 2003). Similarly, from a diachronic perspective various behaviors related to intra-species competition or predator-prey relationships may have played a role in the evolution of human abilities, for example defensive immobilization is hypothesized to have played a role in the evolution of both human parent-child attachment and theory of mind.Pdf.
|
|
Anterior interosseous syndrome is a medical condition in which damage to the anterior interosseous nerve (AIN), a distal motor and sensory branch of the median nerve, classically with severe weakness of the pincer movement of the thumb and index finger, and can cause transient pain in the wrist (the terminal, sensory branch of the AIN innervates the bones of the carpal tunnel). Most cases of AIN syndrome are now thought to be due to a transient neuritis, although compression of the AIN in the forearm is a risk, such as pressure on the forearm from immobilization after shoulder surgery. Trauma to the median nerve or around the proximal median nerve have also been reported as causes of AIN syndrome. Although there is still controversy among upper extremity surgeons, AIN syndrome is now regarded as a neuritis (inflammation of the nerve) in most cases; this is similar to Parsonage–Turner syndrome.
|
|
Cars not originally manufactured to Canadian-market specifications may be legally imported once they are 15 or more years old. This has led to the import of many Japanese sports cars such as the Nissan Skyline. The only categorical exception to the 15-year rule is that many – but not allList of US-specification vehicles admissible and inadmissible to Canada – vehicles manufactured to United States-market specifications can legally be imported into Canada under the compliance modification and inspection program administered by the Registrar of Imported Vehicles. Typically, modifications to meet Canadian standards include the installation of daytime running lights and tether anchors to permit secure attachment of infant car seats, documentation indicating that any repairs required in response to the original manufacturer's factory recalls are complete, and passenger cars assembled on or after September 1, 2007 are also required to have an immobilization system that meets the CMVSS 114 standard.
|
|
Legislation passed in the mid-1970s in the United States mandates two processes affecting securities and their transfer: immobilisation and later, dematerialisation - the first requires paper securities to be kept in one central location and their ownership to be changed through transactions, rather than the piece of paper itself being transferred, and the second allows ownership to be simply recorded electronically without any paper certificate being created at all. These changes were made to allow more trades to happen, and for them to happen faster, in response to demand from the markets. These changes also had the effect of separating companies from their shareholders, and putting intermediaries between them. Immobilization led to greater need for such intermediaries and created a new situation where shareholders voted by proxy instead of directly, and this in turn led a new industry to manage the shareholder voting process.
|
|
Some adoptees are concerned with a feeling of isolation and alienation from past generations; their adoption disrupts the continuity of generations that natural families have. This wall between the past and the present can create the perception that there is a wall between the present and the future as well. The feeling of genealogical bewilderment in these individuals is often seen as stronger during the adoptee's marriage, birth of children, and the deaths of the adoptive parents.Sorosky, A. D., Baran, A. & Pannor, R. (1975). “Identity conflicts in adoptees”. “American Journal of Orthopsychiatry,”(45): 18–27. Adoptee identity formation is described as “ongoing resentment and immobilization stemming from a sense of powerlessness and disadvantage in relation to “regular” people; anxiety and ambivalence related to body-image, sexual relationships, and reproduction; and a driven need to experience human connectedness, described as a sense of not being really human or feeling real” as a result of not knowing their biological history.Brodzinsky, D.M. & Schechter M.D. (1990). “The psychology of adoption”.
|
|
A Fellow of Oak Ridge National Laboratory (ORNL) , the University of Chicago/CASE and Northwestern University/NAISE collaboratories, Zaluzec has and continues to hold the tripartite role of Senior Scientist, Educator and Inventor at Argonne. As an innovator, his research includes development state- of-the art of instrumentation and techniques for atomic resolution x-ray & electron spectroscopy, and electron microscopy. In addition to creating tools for science, as a researcher he also uses these bleeding edge technologies to study vexing problems in technologically important materials. His work over the last 40 years at Argonne has included studies in the areas of structural phase transformation in metals, radiation damage in alloys, ceramic oxides for geologic immobilization of nuclear waste materials, elemental segregation in a wide range of materials ranging from metals and catalysts to semiconductors and superconductors, magnetic dichroism, studies of optical photovoltaics and plasmonics in coupled and hybrid nanostructures, and more recently photo- catalysts, bio-materials and the interaction of particles in nanofluidic systems.
|
|
With constitutional crises, political immobilization, ethnic passion, limited bi-communal interaction and underground military groups emerging in the highly unstable climate of the Republic of Cyprus, "the political and psychological setting was ripe for an open confrontation." With the spark of conflict ignited by factors such as President Makarios’ Thirteen- Point proposal, and the Nicosia incident, after three years of ongoing tension between Turkish and Greek Cypriots and with fruitless efforts to reconcile their broad spectrum of grievances, "a complete constitutional breakdown and eruption of violence occurred in December 1963."Joseph, 25 Despite various attempts made by the Guarantor powers to restore peace and order in the region through measures such as the Green Line and the failure of the international conference, British and Cypriot governments brought the issue to the UN Security Council on February 14, 1964. Recommending the creation of a United Nations Peacekeeping Force in Cyprus (UNFICYP ) to restore law and order, even the adoption of this UN resolution did not prevent further fighting.
|
|
However, many of these problems were resolved in 1998. In that year, it was announced that researchers had managed to completely oxidize methanol using a series (or “cascade”) of enzymes in a biofuel cell. Previous to this time, the enzyme catalysts had failed to completely oxidize the cell's fuel, delivering far lower amounts of energy than what was expected given what was known about the energy capacity of the fuel. While methanol is now far less relevant in this field as a fuel, the demonstrated method of using a series of enzymes to completely oxidize the cell's fuel gave researchers a way forward, and much work is now devoted to using similar methods to achieve complete oxidation of more complicated compounds, such as glucose. In addition, and perhaps what is more important, 1998 was the year in which enzyme “immobilization” was successfully demonstrated, which increased the usable life of the methanol fuel cell from just eight hours to over a week.
|
|
Law enforcement agency ESU members must maintain the highest level of physical agility and personal health at all times in order to meet the crisis challenges of tactical situations. ESU officers usually have at least five-(5) years experience as a patrol officer before being appointed to an ESU assignment. Then the candidate usually completes a minimum of eight months of specialized technical rescue training in the arenas of medical first respondent or EMT training/certification, fire suppression, vehicle and machinery victim extrication, swift water rescue, structural collapse rescue, high and low-angle tactical rope rescue, confined space rescue, trench rescue and water rescue. ESU members' tactical SWAT training includes the use of irritant chemical agents, HAZMAT personal protective equipment (PPE), victim technical rescue equipment, forcible entry techniques, elevator rescue, HAZMAT detection instruments, HAZMAT decontamination, dangerous animal and reptile management, defensive electronic immobilization shields, barricade response, tactical formations, and the use of a myriad of both semi-automatic and fully automatic firearms.
|
|
Steroidogenesis Bonnet macaque Moudgal's early researches at the University of Madras were on the biochemistry of thyroid hormones but he shifted his focus to pituitary gonadotropins during his days at Choh Hao Li's laboratory at the University of California, Berkeley when he established that the hormones generated immune response in living beings and the discovery was reported to be a significant one as the belief till then was the principal function of the hormones was reproduction. Later, at Rodney Porter's laboratory in London, he worked on the role of cellulose as a carrier for immobilization of antibodies. Back in India, he expanded the scope of his researches to cover wider aspects of reproductive biology for which he established a Primate Research Laboratory at IISc in 1965, which was the largest primate house in the country at that time. Working on the macaques in his primate house, he discovered that sialidase from the kidney of the primate acted as an inhibitor of follicle stimulating hormone (FSH), a hormone responsible for pubertal development.
|
|
Because sugars and other biofuels can be grown and harvested on a massive scale, the fuel for enzymatic biofuel cells is extremely cheap and can be found in nearly any part of the world, thus making it an extraordinarily attractive option from a logistics standpoint, and even more so for those concerned with the adoption of renewable energy sources. Enzymatic biofuel cells also have operating requirements not shared by traditional fuel cells. What is most significant is that the enzymes that allow the fuel cell to operate must be “immobilized” near the anode and cathode in order to work properly; if not immobilized, the enzymes will diffuse into the cell's fuel and most of the liberated electrons will not reach the electrodes, compromising its effectiveness. Even with immobilization, a means must also be provided for electrons to be transferred to and from the electrodes. This can be done either directly from the enzyme to the electrode (“direct electron transfer”) or with the aid of other chemicals that transfer electrons from the enzyme to the electrode (“mediated electron transfer”).
|
|